ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal21i16 |
|---|---|
| Clone Library Name | barley_pub |
>PA2G6_RAT (P97570) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 751 Score = 37.0 bits (84), Expect = 0.037 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -2 Query: 527 LEVTDLLRGVPGQEDIHLGLELDQRSCLHGEEQVACVRAVPSEHLPTVVH 378 L++TDL+R P HL +EL R C H + C + +E T +H Sbjct: 107 LQLTDLIRNHPSWTVTHLAVELGIRECFHHSRIITCANSTENEEGCTPLH 156
>PA2G6_MOUSE (P97819) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 752 Score = 35.8 bits (81), Expect = 0.083 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -2 Query: 551 SVEVAALDL--EVTDLLRGVPGQEDIHLGLELDQRSCLHGEEQVACVRAVPSEHLPTVVH 378 SV+V +++ +TDL+R P HL +EL R C H ++C + +E T +H Sbjct: 98 SVQVLHVEVLQHLTDLIRNHPSWTVTHLAVELGIRECFHHSRIISCANSTENEEGCTPLH 157
>PA2G6_HUMAN (O60733) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 806 Score = 35.0 bits (79), Expect = 0.14 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -2 Query: 521 VTDLLRGVPGQEDIHLGLELDQRSCLHGEEQVACVRAVPSEHLPTVVH 378 +TDL+R P HL +EL R C H ++C +E T +H Sbjct: 110 LTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLH 157
>PTG3C_STRPN (P35595) PTS system glucose-specific EIICBA component (EIICBA-Glc)| (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (EC 2.7.1.6 Length = 726 Score = 32.3 bits (72), Expect = 0.92 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 11/81 (13%) Frame = +3 Query: 231 LSDGDFAIIDANGAVVLKVKGAIFSI-----------RSRRTILDGAGMPLLTMQEKAFS 377 + DG FA+ ANG +V V G + SI + +L G+ ++++ K F+ Sbjct: 604 MGDG-FAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSLEGKPFT 662 Query: 378 MHHRWQVFRGDSTNAGDLLFT 440 +H V G AGDLL T Sbjct: 663 VH----VAEGQKVAAGDLLVT 679
>POLG_DEN1T (P29983) Genome polyprotein [Contains: Envelope protein M (Matrix| protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 555 Score = 31.6 bits (70), Expect = 1.6 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = +3 Query: 291 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 437 GA+ S RT LD M LLTM+EK++ +H +W + G ST N DLL Sbjct: 228 GALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 287 Query: 438 TVKT 449 T KT Sbjct: 288 TFKT 291
>POLG_DEN1S (P33478) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3396 Score = 31.6 bits (70), Expect = 1.6 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = +3 Query: 291 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 437 GA+ S RT LD M LLTM+EK++ +H +W + G ST N DLL Sbjct: 459 GALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 518 Query: 438 TVKT 449 T KT Sbjct: 519 TFKT 522
>POLG_DEN18 (P27910) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 792 Score = 30.4 bits (67), Expect = 3.5 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = +3 Query: 291 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 437 GA+ S RT LD M LLTM++K++ +H +W + G ST N DLL Sbjct: 459 GALTLDCSPRTGLDFNRMVLLTMEKKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 518 Query: 438 TVKT 449 T KT Sbjct: 519 TFKT 522
>POLG_DEN1W (P17763) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A)] (Fragment) Length = 1226 Score = 30.4 bits (67), Expect = 3.5 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = +3 Query: 291 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 437 GA+ S RT LD M LLTM++K++ +H +W + G ST N DLL Sbjct: 459 GALTLDCSPRTGLDFNEMVLLTMEKKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 518 Query: 438 TVKT 449 T KT Sbjct: 519 TFKT 522
>LRC56_MOUSE (Q8K375) Leucine-rich repeat-containing protein 56| Length = 552 Score = 29.6 bits (65), Expect = 5.9 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 53 EQAEQTPPATHRLPPRSCSEAPRTDG 130 EQ +QT P T PPR SE RT G Sbjct: 419 EQEDQTGPKTSLTPPRLVSELSRTSG 444
>K1683_MACFA (Q8WNU4) Protein KIAA1683 homolog (Fragment)| Length = 798 Score = 29.6 bits (65), Expect = 5.9 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 409 SPLNTCQRWCILNAFSCMVRRGIPAPSRMVRRLRMLKMAPLTLSTTAP-LASMMAKSPS 236 SPL TC N S M G+ PSR R M+ P L + A L ++ SP+ Sbjct: 85 SPLQTCLAATTSNTSSQMSPVGLTKPSRQTRLAAMITKTPAQLRSVATILKTLCLASPT 143
>PDLI7_XENLA (Q6INU3) PDZ and LIM domain protein 7| Length = 421 Score = 29.3 bits (64), Expect = 7.8 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +1 Query: 7 PSGETRQXTRTESIARASGADTTCH--PPSPS 96 P G+ + ++ +++ SG DTT H PP+PS Sbjct: 153 PQGQLQNGQKSRTVSNVSGKDTTDHPIPPAPS 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,659,131 Number of Sequences: 219361 Number of extensions: 1081763 Number of successful extensions: 4252 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4240 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
