| Clone Name | baal20p18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HUNB_DROTA (O46260) Protein hunchback (Fragments) | 29 | 3.8 | 2 | HUNB_DRODA (O46262) Protein hunchback (Fragments) | 29 | 3.8 | 3 | HRP2_PLAFA (P05228) Histidine-rich protein precursor (Clone PFHR... | 28 | 5.0 | 4 | HRP1_PLAFA (P05227) Histidine-rich protein precursor (Clone PFHR... | 28 | 8.5 |
|---|
>HUNB_DROTA (O46260) Protein hunchback (Fragments)| Length = 192 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 175 NLKNNQILHKHHLFSVHTPTHHLDSPSHAKS 83 N+K I H HH H +HH DS S+A S Sbjct: 9 NIKQEPISHHHHHHHAH-HSHHADSNSNASS 38
>HUNB_DRODA (O46262) Protein hunchback (Fragments)| Length = 195 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -2 Query: 175 NLKNNQILHKHHLFSVHTPTHHLDSPSHAKSISPER 68 N+K I H HH H H DS S++ + SP + Sbjct: 9 NIKQEPISHHHHHHHAHHSHHAHDSNSNSNASSPHQ 44
>HRP2_PLAFA (P05228) Histidine-rich protein precursor (Clone PFHRP-III)| Length = 241 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 Query: 151 HKHHLFSVHTPTHHLDSPSHAKSISPERHAAQQHPSA 41 H HH+ H HH+ HA + HAA H +A Sbjct: 59 HAHHVADAHH-AHHVADAHHAHHAANAHHAANAHHAA 94
>HRP1_PLAFA (P05227) Histidine-rich protein precursor (Clone PFHRP-II)| Length = 332 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -2 Query: 151 HKHHLFSVHTPTHHLDSPSHAKSISPERHAAQQHPSA 41 H HH H HH HA S HAA H +A Sbjct: 143 HAHHAADAHH-AHHAAYAHHAHHASDAHHAADAHHAA 178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,246,088 Number of Sequences: 219361 Number of extensions: 472276 Number of successful extensions: 1469 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1466 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)