| Clone Name | baal21d15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | L_PI2HT (P26676) Large structural protein (Protein L) (Transcrip... | 30 | 1.2 | 2 | SUCR1_MOUSE (Q99MT6) Succinate receptor 1 (G-protein coupled rec... | 30 | 1.5 | 3 | GCF_HUMAN (P16383) GC-rich sequence DNA-binding factor (GCF) (Tr... | 28 | 5.7 |
|---|
>L_PI2HT (P26676) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2262 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 293 YIFPLR*NMQPNTCSVVTTSYKPICTNSS*FHDKCTRSYVYNTNNPAHT 147 Y FP M P +V T Y +C ++ D + Y+YN NP T Sbjct: 1629 YTFPKIKGMPPEEKCLVLTEYLAMCYQNTHHLDPDLQKYLYNLTNPKLT 1677
>SUCR1_MOUSE (Q99MT6) Succinate receptor 1 (G-protein coupled receptor 91)| Length = 317 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -1 Query: 321 FYAIQYVFCIYISFAVKYATQYMFCSHNFLQANLYKF 211 FYAI+++F + + V + Y+FC N+ +N+Y F Sbjct: 25 FYAIEFIFGLLGNVTVVFG--YLFCMKNWNSSNVYLF 59
>GCF_HUMAN (P16383) GC-rich sequence DNA-binding factor (GCF) (Transcription| factor 9) (TCF-9) Length = 784 Score = 28.1 bits (61), Expect = 5.7 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 244 TTEHVLGCIFHRKGNIYTEDVLDCVKKK 327 ++ L C F++ IY E+++DC+ +K Sbjct: 316 SSNQALNCKFYKSMKIYVENLIDCLNEK 343 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,604,755 Number of Sequences: 219361 Number of extensions: 809447 Number of successful extensions: 1444 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1444 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)