| Clone Name | baal20n14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SSPO_BOVIN (P98167) SCO-spondin (Fragment) | 31 | 1.1 |
|---|
>SSPO_BOVIN (P98167) SCO-spondin (Fragment)| Length = 867 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +1 Query: 40 WCELQNPANXRVFERKLR----PRPLGRGHACLGVTPK 141 W E P R + R PRP GRGH C G+ K Sbjct: 197 WAECLGPCGSRSVQWSFRSPNNPRPAGRGHQCRGLHRK 234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,828,523 Number of Sequences: 219361 Number of extensions: 305190 Number of successful extensions: 886 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)