| Clone Name | baal21c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TILS_WOLPM (Q73FR9) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 30 | 3.0 | 2 | CH601_RHOSH (P20110) 60 kDa chaperonin 1 (Protein Cpn60 1) (groE... | 29 | 8.7 | 3 | WDR19_HUMAN (Q8NEZ3) WD-repeat protein 19 | 29 | 8.7 |
|---|
>TILS_WOLPM (Q73FR9) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 431 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 137 SVNAPL-EPQTWEGSFLCGLLKNQPQIFLVAAARQLQQLSIQRKD 268 +VN PL EP W+ F C +L NQ ++A ++ Q++ KD Sbjct: 331 TVNLPLNEPTQWDNRFSCTILGNQGCSVIIAPLKKTQKVPEFLKD 375
>CH601_RHOSH (P20110) 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1)| Length = 546 Score = 28.9 bits (63), Expect = 8.7 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 50 DMLNRRSKCTSRKLLTTVTGAKGDESEFDSVNAPLEPQTWEGS 178 DML R K + K TT+ GD++E D+ A + Q E S Sbjct: 314 DMLGRAKKISINKDNTTIVDGNGDKAEIDARVAQIRNQIEETS 356
>WDR19_HUMAN (Q8NEZ3) WD-repeat protein 19| Length = 1342 Score = 28.9 bits (63), Expect = 8.7 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 3/79 (3%) Frame = +2 Query: 188 GLLKNQPQIFLVAAARQLQQLSIQRKDTLTRWEHSIGS---PEDCLHRRIAEMKEQECRT 358 G+ K+ +F + A + + + Q + R E S G+ D L AE+K Q+ + Sbjct: 1084 GMPKDAKYLFRLYMALKQYREAAQTAIIIAREEQSAGNYRNAHDVLFSMYAELKSQKIKI 1143 Query: 359 AIEDVMYMLIVHKYSKIEV 415 E ++I+H Y +++ Sbjct: 1144 PSEMATNLMILHSYILVKI 1162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,277,878 Number of Sequences: 219361 Number of extensions: 1550511 Number of successful extensions: 3950 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3950 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)