| Clone Name | baal20l21 |
|---|---|
| Clone Library Name | barley_pub |
>ETF1_SFVKA (P32096) Early transcription factor 70 kDa subunit (EC 3.6.1.-)| (ATP-dependent helicase VETFS) (VETF small subunit) Length = 635 Score = 40.0 bits (92), Expect = 0.006 Identities = 21/67 (31%), Positives = 38/67 (56%) Frame = +1 Query: 361 LDSYSGEELNSQRFDHSVAQIIPLILKDSSEQRLHLIVDSNSNAHLYPRSPDALNSFMTE 540 LD YS EE+N+ FD + +++ L K R++ I++S S+++ P P + + E Sbjct: 486 LDDYSLEEINTLPFD--IKKLLYLKFKTKETNRIYSILESISDSYTQPPHPHIVEIVLGE 543 Query: 541 MSNQYFY 561 + Q+FY Sbjct: 544 IVRQFFY 550
>ETF1_MYXVL (Q9Q8L9) Early transcription factor 70 kDa subunit (EC 3.6.1.-)| (ATP-dependent helicase VETFS) (VETF small subunit) Length = 635 Score = 38.9 bits (89), Expect = 0.013 Identities = 20/67 (29%), Positives = 38/67 (56%) Frame = +1 Query: 361 LDSYSGEELNSQRFDHSVAQIIPLILKDSSEQRLHLIVDSNSNAHLYPRSPDALNSFMTE 540 LD YS EE+N+ FD + +++ L K R++ I+++ S+++ P P + + E Sbjct: 486 LDDYSLEEINTLPFD--IKKLLYLKFKTKETNRIYSILENISDSYTQPPHPHIVEIVLGE 543 Query: 541 MSNQYFY 561 + Q+FY Sbjct: 544 IVRQFFY 550
>YOS1_SCHPO (P87319) Hypothetical protein C21C3.01c in chromosome II| Length = 3011 Score = 30.8 bits (68), Expect = 3.6 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 5/92 (5%) Frame = +1 Query: 379 EELNSQRFDHSVAQIIPLILKDSSEQRLHLIVDSNSN----AHLYPRSPDAL-NSFMTEM 543 E L R + I PLI D E + +++VD N H+ RSP L N E+ Sbjct: 1875 ESLRHVRVNRVGEHIYPLISYDQDELKHYMVVDVNLGEDYIKHITLRSPLLLINETQMEI 1934 Query: 544 SNQYFYSVDIQKNAIRGYSLQKSCDFDSGDTY 639 + S IQ++ I S ++SC Y Sbjct: 1935 DVVFCDSDGIQRSQIYHMSPEESCSLPIETAY 1966
>DSCL1_HUMAN (Q8TD84) Down syndrome cell adhesion molecule-like protein 1| precursor (Down syndrome cell adhesion molecule 2) Length = 2053 Score = 30.8 bits (68), Expect = 3.6 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 472 VDSNSNAHLYPRSPDALNSFMTEMSNQYFYSVDIQKNAIRGYSLQKSCDF 621 V +N LYP SP A NSF+ + N YF + + IR +++ F Sbjct: 76 VHANGTLQLYPFSPSAFNSFIHD--NDYFCTAENAAGKIRSPNIRVKAVF 123
>PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) Length = 5085 Score = 30.0 bits (66), Expect = 6.1 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +1 Query: 100 RDHNGFRKLLIVLTKAGKVIALHTGDGRIIWSNLLPSLRASKSGEMPSALRIYQWQ-VPH 276 +DH G L + GK I H+G+ + +LP A +G + +++ +W VP Sbjct: 4450 KDHTGSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGESAEHTGPLMEGMQVLEWNGVPL 4509 Query: 277 HRVMRENPSILVVGRSGASSV 339 E ++ +SG + + Sbjct: 4510 TSKTYEEVQSIINQQSGEAEI 4530
>NH167_CAEEL (O17683) Nuclear hormone receptor family member nhr-167| Length = 343 Score = 29.6 bits (65), Expect = 8.0 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +1 Query: 430 LILKDSSEQRLHLIVDSNSNAHLYPRSPDALNSFMTEMSNQYFYSVDIQK 579 L+L+ + EQRL + +D N H R N F+TEM+ V++ K Sbjct: 81 LVLEQNKEQRLAITIDCVRNTH-NKRMDSLFNFFVTEMNPNVDDIVELNK 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,038,524 Number of Sequences: 219361 Number of extensions: 1915361 Number of successful extensions: 5337 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5337 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)