| Clone Name | baal21a17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor ... | 33 | 0.17 | 2 | V018_FOWPV (Q9J5I3) Putative ankyrin repeat protein FPV018 | 28 | 7.2 | 3 | META_BACFR (Q64YS9) Homoserine O-succinyltransferase (EC 2.3.1.4... | 28 | 9.4 |
|---|
>NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.-)| (Nepenthesin-I) Length = 437 Score = 33.5 bits (75), Expect = 0.17 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 1 HFQGADLELPRRNYVLDDPRRGSLCILLADS 93 HF G DLELP NY + P G +C+ + S Sbjct: 372 HFDGGDLELPSENYFI-SPSNGLICLAMGSS 401
>V018_FOWPV (Q9J5I3) Putative ankyrin repeat protein FPV018| Length = 700 Score = 28.1 bits (61), Expect = 7.2 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 Query: 10 GADLELPRRNYVLDDPRRGSLCI 78 GADL++ R+YVLD + GS CI Sbjct: 150 GADLKMVCRSYVLDFYKGGSYCI 172
>META_BACFR (Q64YS9) Homoserine O-succinyltransferase (EC 2.3.1.46) (Homoserine| O-transsuccinylase) (HTS) Length = 305 Score = 27.7 bits (60), Expect = 9.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 7 QGADLELPRRNYVLDDPRRGSL 72 +G +E+PR YV DDP +G L Sbjct: 253 KGLPIEIPRNYYVNDDPDKGPL 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,359,411 Number of Sequences: 219361 Number of extensions: 157898 Number of successful extensions: 655 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 80,573,946 effective HSP length: 11 effective length of database: 78,160,975 effective search space used: 1875863400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)