| Clone Name | baal20k15 |
|---|---|
| Clone Library Name | barley_pub |
>EPHB4_HUMAN (P54760) Ephrin type-B receptor 4 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor HTK) Length = 987 Score = 29.6 bits (65), Expect = 2.1 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 11/73 (15%) Frame = -3 Query: 207 LLSLRLMYELLTSWTVLLLSGDDDIER-----------LXSNVAPNPYPXLEFCASYAIS 61 LLSL L Y+ TV L + + R + + AP P P L +C Sbjct: 187 LLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSL-YCREDGQW 245 Query: 60 AVKPCRSCSCATG 22 A +P CSCA G Sbjct: 246 AEQPVTGCSCAPG 258
>TRDH_YMTV (Q6TUQ9) Transcript release DNA helicase (EC 3.6.1.-)| Length = 478 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 144 DDDIERLXSNVAPNPYPXLEFCASYAISAVK 52 D+DIE + V PN YP E AS +S++K Sbjct: 66 DNDIEHSKNVVMPNLYPFQERVASEVLSSIK 96
>SPB4_NEUCR (Q873H9) ATP-dependent rRNA helicase spb-4 (EC 3.6.1.-)| Length = 654 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 109 RNIRTQPFNVIVTGQQQHRPGCEQLVHEAQREQRRP 216 R + TQ +NV+V+ + H P E + H A+ +++RP Sbjct: 100 RELATQIYNVLVSLVKFHEPSAEAISH-AKSDEKRP 134
>GIT1_RAT (Q9Z272) ARF GTPase-activating protein GIT1 (G protein-coupled| receptor kinase-interactor 1) (GRK-interacting protein 1) (Cool-associated and tyrosine-phosphorylated protein 1) (Cat-1) Length = 770 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 118 ECCAKSVPTVRVLCIVRHLRREALP--LMQLRHRLTGH 11 ECC+ R + IV+HLR A P L+Q+ H L + Sbjct: 33 ECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASN 70
>GIT1_MOUSE (Q68FF6) ARF GTPase-activating protein GIT1 (G protein-coupled| receptor kinase-interactor 1) (GRK-interacting protein 1) Length = 770 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 118 ECCAKSVPTVRVLCIVRHLRREALP--LMQLRHRLTGH 11 ECC+ R + IV+HLR A P L+Q+ H L + Sbjct: 33 ECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASN 70
>GIT1_HUMAN (Q9Y2X7) ARF GTPase-activating protein GIT1 (G protein-coupled| receptor kinase-interactor 1) (GRK-interacting protein 1) (Cool-associated and tyrosine-phosphorylated protein 1) (Cat-1) Length = 761 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 118 ECCAKSVPTVRVLCIVRHLRREALP--LMQLRHRLTGH 11 ECC+ R + IV+HLR A P L+Q+ H L + Sbjct: 33 ECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASN 70
>Y2090_ARATH (O04212) Putative ABC1 protein At2g40090 precursor| Length = 538 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 51 ASRRRWRTMHKTLTVGTDLAQHSNXAF 131 A+R WRT K L VGT L S AF Sbjct: 2 AARSLWRTRTKLLVVGTALCGGSGAAF 28 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,784,643 Number of Sequences: 219361 Number of extensions: 451574 Number of successful extensions: 1527 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1527 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)