| Clone Name | baal20h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APE2_SULTO (Q974N6) Probable aminopeptidase 2 (EC 3.4.11.-) | 31 | 3.1 | 2 | CAD17_HUMAN (Q12864) Cadherin-17 precursor (Liver-intestine-cadh... | 30 | 6.8 | 3 | Y453_METJA (Q57895) Hypothetical protein MJ0453 | 30 | 6.8 | 4 | UPPP_BUCAP (Q8KA52) Undecaprenyl-diphosphatase (EC 3.6.1.27) (Un... | 30 | 8.9 |
|---|
>APE2_SULTO (Q974N6) Probable aminopeptidase 2 (EC 3.4.11.-)| Length = 781 Score = 31.2 bits (69), Expect = 3.1 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -3 Query: 438 DAYPIYYQKIPYMNTQKSENILSVRITKFAKNKKEEEKRTWKYRFSTF 295 D Y + Y+ +PY ++ +F+K K E +RT+ Y STF Sbjct: 569 DKYKLLYEVLPY------------QVKRFSKRKDELSRRTYSYLLSTF 604
>CAD17_HUMAN (Q12864) Cadherin-17 precursor (Liver-intestine-cadherin)| (LI-cadherin) (Intestinal peptide-associated transporter HPT-1) Length = 832 Score = 30.0 bits (66), Expect = 6.8 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = -3 Query: 180 VWKVPKIVEATREHTE*PH----SQVGLCDSSCQECKAAKQKFPRF 55 +WK PK VE T+ PH +QV D Q K+K PRF Sbjct: 238 IWKAPKPVEMVENSTD-PHPIKITQVRWNDPGAQYSLVDKEKLPRF 282
>Y453_METJA (Q57895) Hypothetical protein MJ0453| Length = 107 Score = 30.0 bits (66), Expect = 6.8 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -3 Query: 474 QGEMVSGLPKLIDAYPIYYQKIPYMNTQKSENILSVRITKFAKNKKEEEK 325 +G + G+P + AY Y PY +L + + + K+KKEE+K Sbjct: 42 EGIFLIGIPPIPVAYEDNYVIFPYTKPCYGTFVLKINLDEINKDKKEEKK 91
>UPPP_BUCAP (Q8KA52) Undecaprenyl-diphosphatase (EC 3.6.1.27) (Undecaprenyl| pyrophosphate phosphatase) (Bacitracin resistance protein) Length = 264 Score = 29.6 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 131 HSVCSLVASTILGT-FHTKIKRTFDTQNIIQSCLLGFFYFI 250 H + S++ + LG F+ KIK F+ N++ + +LG F+ I Sbjct: 87 HVLISILPTMFLGLIFYNKIKSLFNPTNVMYALILGGFFLI 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,920,899 Number of Sequences: 219361 Number of extensions: 2160597 Number of successful extensions: 4794 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4794 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)