| Clone Name | baal20g17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GPMA_BUCAI (P57390) 2,3-bisphosphoglycerate-dependent phosphogly... | 30 | 4.0 | 2 | GLND_STRCO (O69873) [Protein-PII] uridylyltransferase (EC 2.7.7.... | 30 | 4.0 | 3 | NRP1_XENLA (P28824) Neuropilin-1 precursor (A5 protein) (A5 anti... | 30 | 5.3 | 4 | NUB1_MOUSE (P54729) NEDD8 ultimate buster 1 (Protein BS4) | 29 | 6.9 |
|---|
>GPMA_BUCAI (P57390) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase| (EC 5.4.2.1) (Phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (dPGM) Length = 231 Score = 30.0 bits (66), Expect = 4.0 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 467 RXFHTTSPEVNIGDVRRPGDDPLDGVEDKLAIHKVP 360 R F + P++NI D R PG+DP L IH +P Sbjct: 117 RSFDISPPQINIKDKRFPGNDPR---YSHLNIHDIP 149
>GLND_STRCO (O69873) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 835 Score = 30.0 bits (66), Expect = 4.0 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +1 Query: 94 PGGTRGSTQARRWALPRRYGSLPCASATLSAVLVREIIG 210 P G GS W + +YGSLP A A L A LVR + G Sbjct: 688 PDGVEGSVLLLDWRVAAQYGSLPQA-ARLRADLVRALDG 725
>NRP1_XENLA (P28824) Neuropilin-1 precursor (A5 protein) (A5 antigen)| Length = 928 Score = 29.6 bits (65), Expect = 5.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 47 LRLFAPGRDAASSSATPAVPEAVPRRGGGRCRGDTVRCHA 166 LRL G + + ++ P PE GG C GD CH+ Sbjct: 577 LRLELLGCEVETPTSIPTTPEV---NGGDECEGDLANCHS 613
>NUB1_MOUSE (P54729) NEDD8 ultimate buster 1 (Protein BS4)| Length = 614 Score = 29.3 bits (64), Expect = 6.9 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +3 Query: 336 MPSMEGFVRYLVDSKLVFDTVERIIAGSTDVAYVYFRRSGMEXAASIEKDL 488 +P + RY + K + DTV+ D+ + YFR +E EK L Sbjct: 256 LPCLLDADRYFCECKELLDTVDNYAVLQLDIVWCYFRLEQLECLDDAEKKL 306 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,956,428 Number of Sequences: 219361 Number of extensions: 825487 Number of successful extensions: 2794 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2794 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)