| Clone Name | baal20g16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMX3_CAEEL (P34511) Hypothetical protein K06H7.3 | 28 | 8.4 | 2 | PGBM_MOUSE (Q05793) Basement membrane-specific heparan sulfate p... | 28 | 8.4 |
|---|
>YMX3_CAEEL (P34511) Hypothetical protein K06H7.3| Length = 618 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/45 (31%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +1 Query: 76 DACSCSLRAWNQSLV-DRSSCFTCSVPVDFSSSVVNIRKFSSCIY 207 DA + W L D C TC+ PVDF V + + S + Sbjct: 41 DAGMSLMLEWKMRLSEDSDQCTTCNCPVDFGDRAVLLEHYQSLFH 85
>PGBM_MOUSE (Q05793) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 3707 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 127 SSCFTCSVPVDFSSSVVNIRK 189 SS +TC P F+++ VNIRK Sbjct: 3182 SSSYTCVCPAGFTAAAVNIRK 3202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,903,772 Number of Sequences: 219361 Number of extensions: 389939 Number of successful extensions: 1138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)