| Clone Name | baal20d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ECA3_ARATH (Q9SY55) Calcium-transporting ATPase 3, endoplasmic r... | 28 | 5.4 | 2 | SDK1_CHICK (Q8AV58) Protein sidekick-1 precursor | 28 | 7.0 | 3 | SPEA_GLOVI (Q7NE10) Biosynthetic arginine decarboxylase (EC 4.1.... | 28 | 7.0 | 4 | KR103_HUMAN (P60369) Keratin-associated protein 10-3 (Keratin-as... | 28 | 7.0 |
|---|
>ECA3_ARATH (Q9SY55) Calcium-transporting ATPase 3, endoplasmic reticulum-type| (EC 3.6.3.8) Length = 998 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 290 TRDRGRSDILCTHHQLSFRFSHG 222 TRDR +LC+H Q+ FS G Sbjct: 490 TRDRKMMSVLCSHKQMDVMFSKG 512
>SDK1_CHICK (Q8AV58) Protein sidekick-1 precursor| Length = 2169 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 357 ELSSQSHSDSRANLKLSHWLQGNTGSRPIRY 265 +L++ S +L+L HW+ G+ GS PIRY Sbjct: 1434 QLTTPQSDVSSRSLQL-HWVPGSDGSSPIRY 1463
>SPEA_GLOVI (Q7NE10) Biosynthetic arginine decarboxylase (EC 4.1.1.19) (ADC)| Length = 644 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/61 (19%), Positives = 28/61 (45%) Frame = -1 Query: 366 NTYELSSQSHSDSRANLKLSHWLQGNTGSRPIRYPMHTSSAILQVFARQQHNRRRQTHVQ 187 NT + S + +L H ++G+T + ++Y + A+L+ R+ R+ + Sbjct: 553 NTVHIHLASDEPGEQSYRLEHVVKGDTMTEVLKYVQYDHEAMLESIRRETEQALRERRIT 612 Query: 186 I 184 + Sbjct: 613 L 613
>KR103_HUMAN (P60369) Keratin-associated protein 10-3 (Keratin-associated| protein 10.3) (High sulfur keratin-associated protein 10.3) (Keratin-associated protein 18-3) (Keratin-associated protein 18.3) Length = 221 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +3 Query: 162 TSNPCQ*KSVRAFVYVCCVVAVRKPEG*LMMCA*DIGSASIPCSPVTSG*AS 317 TS+PCQ CCV KP + +C + I C PV SG +S Sbjct: 91 TSSPCQ--------QACCVPVCCKPVCCVPVCCKPVCCKPICCVPVCSGASS 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,353,340 Number of Sequences: 219361 Number of extensions: 699808 Number of successful extensions: 1474 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1474 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)