| Clone Name | baal20c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PFBS_ARATH (Q9SR43) Phytochromobilin:ferredoxin oxidoreductase, ... | 30 | 2.3 | 2 | CAC1B_RAT (Q02294) Voltage-dependent N-type calcium channel alph... | 29 | 3.1 | 3 | MBP1_MAIZE (P28794) Antimicrobial peptide MBP-1 | 29 | 3.1 |
|---|
>PFBS_ARATH (Q9SR43) Phytochromobilin:ferredoxin oxidoreductase, chloroplast| precursor (EC 1.3.7.4) (Phytochromobilin synthase) (PFB synthase) (PPhiB synthase) Length = 329 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 102 EATKQVLPRRGPSRARAHCQRQHSASPWRTTR 7 E T QV PS RA+C+ QH WR + Sbjct: 224 EMTIQVREEMEPSHVRANCEAQHKYLTWRAQK 255
>CAC1B_RAT (Q02294) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2336 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 30 PSAVAGSGLEHGKGLVGAR 86 PS AGSGL HG+G G R Sbjct: 2080 PSTAAGSGLPHGEGSTGCR 2098
>MBP1_MAIZE (P28794) Antimicrobial peptide MBP-1| Length = 33 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -3 Query: 78 RRGPSRARAHCQRQHSASPWRTTRC 4 R G R C R+H PW T C Sbjct: 1 RSGRGECRRQCLRRHEGQPWETQEC 25 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,556,765 Number of Sequences: 219361 Number of extensions: 392457 Number of successful extensions: 1446 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1446 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)