| Clone Name | baal20b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ST7R_ARATH (Q9LDU6) 7-dehydrocholesterol reductase (EC 1.3.1.21)... | 50 | 3e-06 | 2 | PLIGA_ELAQU (Q9PWI4) Phospholipase A2 inhibitor gamma subunit A ... | 29 | 9.6 | 3 | ATG19_YEAST (P35193) Autophagy-related protein 19 (Cytoplasm-to-... | 29 | 9.6 |
|---|
>ST7R_ARATH (Q9LDU6) 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC| reductase) (Sterol delta-7-reductase) (Dwarf5 protein) Length = 432 Score = 50.4 bits (119), Expect = 3e-06 Identities = 22/40 (55%), Positives = 23/40 (57%) Frame = +3 Query: 51 PGKRFEGPISPSGNVPVYKANGXXXXXXXXXXXXXXWW*G 170 PGKR EGPISP+GN PVYKANG WW G Sbjct: 85 PGKRVEGPISPAGNRPVYKANGLAAYFVTLATYLGLWWFG 124
>PLIGA_ELAQU (Q9PWI4) Phospholipase A2 inhibitor gamma subunit A precursor| (PLI-gamma A) Length = 202 Score = 28.9 bits (63), Expect = 9.6 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = -1 Query: 362 PMSKTSSHHNCFSS*RCQ-KHQMANASAHK*TSHSIVQGRNH-QNDKRCSSK 213 P+S SSH NCFSS C+ +H N + ++GR H ++K+C + Sbjct: 58 PLSIRSSHRNCFSSSLCKLEHFDVNTG-----QETYLRGRIHCCDEKKCEGR 104
>ATG19_YEAST (P35193) Autophagy-related protein 19 (Cytoplasm-to-vacuole| targeting protein 19) Length = 415 Score = 28.9 bits (63), Expect = 9.6 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 251 LEQLNDLSTCVHLHW-PFDVSGSAMRKNNYD 340 L LND + C HL W P D S + NNYD Sbjct: 46 LSLLNDSNGCKHLFWQPNDKSNVRILLNNYD 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,672,622 Number of Sequences: 219361 Number of extensions: 1369296 Number of successful extensions: 2531 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2531 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)