ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal20b01 |
|---|---|
| Clone Library Name | barley_pub |
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 115 bits (289), Expect = 2e-26 Identities = 54/57 (94%), Positives = 54/57 (94%) Frame = +1 Query: 19 NAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 N A LGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE LLKQVDYLIRSKWVPC Sbjct: 32 NGASLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEGLLKQVDYLIRSKWVPC 88
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 114 bits (284), Expect = 9e-26 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 22 AAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 + GL SVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC Sbjct: 33 STGLSSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 88
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 111 bits (277), Expect = 6e-25 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 31 LGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 LGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEAL KQVDYLIRSKWVPC Sbjct: 35 LGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALSKQVDYLIRSKWVPC 87
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 110 bits (275), Expect = 1e-24 Identities = 52/55 (94%), Positives = 52/55 (94%) Frame = +1 Query: 25 AGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 A SVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC Sbjct: 33 ASSASVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 87
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 106 bits (264), Expect = 2e-23 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = +1 Query: 7 RLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 R SGN++ G+VSNGGRIRCMQVWPIEGIKKFETLSYLPPL+ E LLKQ++YL+RSKWVP Sbjct: 29 RRSGNSS-FGNVSNGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVP 87 Query: 187 C 189 C Sbjct: 88 C 88
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 100 bits (248), Expect = 1e-21 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = +1 Query: 25 AGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 +G G+VSNGGRI+ MQVWPIEGIKKFETLSYLPPL+ E LLKQ++YL+RSKWVPC Sbjct: 34 SGFGNVSNGGRIKFMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPC 88
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 97.1 bits (240), Expect = 1e-20 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = +1 Query: 19 NAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 ++ LG+VSNGGRIRCMQVWP G KKFETLSYLPPLST+ LLKQVDYL+R+ W+PC Sbjct: 32 SSRSLGNVSNGGRIRCMQVWPAYGNKKFETLSYLPPLSTDDLLKQVDYLLRNGWIPC 88
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 93.6 bits (231), Expect = 1e-19 Identities = 42/57 (73%), Positives = 46/57 (80%) Frame = +1 Query: 19 NAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 + L VSNGGRIRCMQVWP G KKFETLSYLPPL+ E LLKQVDYL+R+ WVPC Sbjct: 31 STTSLAKVSNGGRIRCMQVWPAYGNKKFETLSYLPPLTQEQLLKQVDYLLRNNWVPC 87
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 90.9 bits (224), Expect = 8e-19 Identities = 36/49 (73%), Positives = 46/49 (93%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWPIEG+KKFETLSYLP + EAL+KQ++YL+RSKW+PC Sbjct: 51 SNGGRVQCMKVWPIEGVKKFETLSYLPTMKDEALVKQIEYLLRSKWIPC 99
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 89.7 bits (221), Expect = 2e-18 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G+KKFETLSYLPPLSTE+L K+VDYL+R WVPC Sbjct: 53 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPC 101
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 89.4 bits (220), Expect = 2e-18 Identities = 40/57 (70%), Positives = 50/57 (87%), Gaps = 1/57 (1%) Frame = +1 Query: 22 AAGLGSV-SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 A GL ++ SNGGR++CM+VWPI G+KKFETLSYLP LS E+LLKQ++YLIR+ WVPC Sbjct: 44 ATGLSTLPSNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRNGWVPC 100
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 89.4 bits (220), Expect = 2e-18 Identities = 40/57 (70%), Positives = 50/57 (87%), Gaps = 1/57 (1%) Frame = +1 Query: 22 AAGLGSV-SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 A GL ++ SNGGR++CM+VWPI G+KKFETLSYLP LS E+LLKQ++YLIR+ WVPC Sbjct: 44 ATGLSTLPSNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRNGWVPC 100
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 89.4 bits (220), Expect = 2e-18 Identities = 40/57 (70%), Positives = 50/57 (87%), Gaps = 1/57 (1%) Frame = +1 Query: 22 AAGLGSV-SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 A GL ++ SNGGR++CM+VWPI G+KKFETLSYLP LS E+LLKQ++YLIR+ WVPC Sbjct: 44 ATGLSTLPSNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRNGWVPC 100
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 89.0 bits (219), Expect = 3e-18 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP EG+KKFETLSYLPPLS E L K+VDYL+R+ WVPC Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPC 98
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 89.0 bits (219), Expect = 3e-18 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP EG+KKFETLSYLPPLS E L K+VDYL+R+ WVPC Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPC 98
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 89.0 bits (219), Expect = 3e-18 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP EG+KKFETLSYLPPLS E L K+VDYL+R+ WVPC Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPC 98
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 88.2 bits (217), Expect = 5e-18 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G+KKFETLSYLPPLS+E+L K+VDYL+R WVPC Sbjct: 53 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPC 101
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 87.8 bits (216), Expect = 7e-18 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGG++ CMQVWP EG+KKFETLSYLPPLS E L K+VDYL+R+ WVPC Sbjct: 50 SNGGKVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPC 98
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 87.8 bits (216), Expect = 7e-18 Identities = 36/49 (73%), Positives = 45/49 (91%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G+KK+ETLSYLPPLS EAL K++DYLIR+KW+PC Sbjct: 50 SNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPC 98
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 87.8 bits (216), Expect = 7e-18 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWPI G+KKFETLSYLP LS E+LLKQ++YLIR+ WVPC Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRNGWVPC 100
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 87.4 bits (215), Expect = 9e-18 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +1 Query: 46 NGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 NGGR+ CMQVWP EG+KKFETLSYLPPLS E L K+VDYL+R+ WVPC Sbjct: 51 NGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPC 98
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 87.0 bits (214), Expect = 1e-17 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 S+GGR+ CMQVWP EG+KKFETLSYLPPLS E L K+VDYL+R+ WVPC Sbjct: 46 SSGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPC 94
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 84.3 bits (207), Expect = 8e-17 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G+KKFETLSYLPPLS E+LLK+V YL+ + WVPC Sbjct: 51 SNGGRVQCMQVWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNNGWVPC 99
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 83.2 bits (204), Expect = 2e-16 Identities = 32/49 (65%), Positives = 44/49 (89%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP + +K++ETLSYLPPL+T+ L +QVDYL+ +KWVPC Sbjct: 50 SNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPC 98
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 82.4 bits (202), Expect = 3e-16 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLPPL+ + LLK+V+YL+R WVPC Sbjct: 50 SNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPC 98
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 82.4 bits (202), Expect = 3e-16 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLPPL+ + LLK+V+YL+R WVPC Sbjct: 50 SNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPC 98
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 82.4 bits (202), Expect = 3e-16 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G+KK+ETLSYLPPL+ L K+VDYL+R KWVPC Sbjct: 48 SNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLAKEVDYLLRKKWVPC 96
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 82.0 bits (201), Expect = 4e-16 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLPPLS E+L+K+V YL+ + WVPC Sbjct: 48 SNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPC 96
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 82.0 bits (201), Expect = 4e-16 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G+KKFETLSYLPPLS+E L K+VDYL+R +PC Sbjct: 52 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPC 100
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 82.0 bits (201), Expect = 4e-16 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLPPLS E+L+K+V YL+ + WVPC Sbjct: 51 SNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPC 99
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 82.0 bits (201), Expect = 4e-16 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +1 Query: 46 NGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 +GGRIRCMQVWPIEGIKKFETLSYLPPL+ E LLKQ++YL + VPC Sbjct: 39 HGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLAPFQVVPC 86
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 81.6 bits (200), Expect = 5e-16 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGG+++CMQVWP G KKFETLSYLPPLS E+LLK+V YL+ + WVPC Sbjct: 54 SNGGKVQCMQVWPPLGKKKFETLSYLPPLSEESLLKEVQYLLNNGWVPC 102
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 81.6 bits (200), Expect = 5e-16 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP G KKFETLSYLPPL+ E L K+V+YLIR W+PC Sbjct: 50 SNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPC 98
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 81.6 bits (200), Expect = 5e-16 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNG R+RCMQVWP EG KKFETLSYLPPL+ E L ++VDYLIR+ W+PC Sbjct: 49 SNGLRVRCMQVWPPEGKKKFETLSYLPPLTREQLGQEVDYLIRNGWIPC 97
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 81.6 bits (200), Expect = 5e-16 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +1 Query: 37 SVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 + SNGGR+RCMQVWP G KFETLSYLP L+ E L+K+V+YL+R+KWVPC Sbjct: 42 TTSNGGRVRCMQVWPPFGNPKFETLSYLPTLTEEQLVKEVEYLLRNKWVPC 92
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 80.9 bits (198), Expect = 9e-16 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP G KKFETLSYLP L+ L K+VDYLIR+KW+PC Sbjct: 48 SNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWIPC 96
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 80.9 bits (198), Expect = 9e-16 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNG R+ CMQVWP G KKFETLSYLPPL+ E LLK+V+YL+R WVPC Sbjct: 48 SNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLLKEVEYLLRKGWVPC 96
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 80.9 bits (198), Expect = 9e-16 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLP L+ L K+VDYL+RSKW+PC Sbjct: 52 SNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWIPC 100
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 80.9 bits (198), Expect = 9e-16 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 +NGGR++CMQVWP G KKFETLSYLPPLS E+L+K+V YL+ + WVPC Sbjct: 50 TNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPC 98
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 80.5 bits (197), Expect = 1e-15 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G++KFETLSYLPPLS E+L KQ++YLI W+PC Sbjct: 52 SNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWIPC 100
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 80.1 bits (196), Expect = 1e-15 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP LS E LLK+V+YL+++ WVPC Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPC 98
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 80.1 bits (196), Expect = 1e-15 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP LS E LLK+V+YL+++ WVPC Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPC 98
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 80.1 bits (196), Expect = 1e-15 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP LS E LLK+V+YL+++ WVPC Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPC 98
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 80.1 bits (196), Expect = 1e-15 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP LS E LLK+V+YL+++ WVPC Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPC 99
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 80.1 bits (196), Expect = 1e-15 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP LS E LLK+V+YL+++ WVPC Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPC 99
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 80.1 bits (196), Expect = 1e-15 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGG+++CM+VWP G+KKFETLSYLPPL+ E L +V+YL+RS W+PC Sbjct: 52 SNGGKVQCMKVWPTLGMKKFETLSYLPPLTREQLASEVEYLLRSGWIPC 100
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 79.3 bits (194), Expect = 3e-15 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNG R++CMQVWP G KKFETLSYLPPL+ + LLK+V+YL+R WVPC Sbjct: 6 SNGERVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPC 54
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 79.0 bits (193), Expect = 3e-15 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP L+ E LLK+V+YL+++ WVPC Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPC 99
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 78.6 bits (192), Expect = 4e-15 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP LS+E LL +++YL+++ WVPC Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSSEQLLSEIEYLLKNGWVPC 98
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLPPLS LL QV YL+ + W+PC Sbjct: 50 SNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNNGWIPC 98
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CM+VWP G KKFETLSYLP LS L K+VDYL+R+KW+PC Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPC 96
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CM+VWP G KKFETLSYLP LS L K+VDYL+R+KW+PC Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPC 96
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CM+VWP G KKFETLSYLP LS L K+VDYL+R+KW+PC Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPC 96
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 78.2 bits (191), Expect = 6e-15 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLPPLS LL QV YL+ W+PC Sbjct: 53 SNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNKGWIPC 101
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = +1 Query: 37 SVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 + SNG R+RCMQVWP KKFETLSYLP L+ E L+K+V+YL+++KWVPC Sbjct: 58 TTSNGSRVRCMQVWPPYANKKFETLSYLPRLTPEQLVKEVEYLLKNKWVPC 108
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 78.2 bits (191), Expect = 6e-15 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +1 Query: 40 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 VSNGGR+ CM+VWP G KKFETLSYLP L+ L K+VDYL+R+KW+PC Sbjct: 47 VSNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELGKEVDYLLRNKWIPC 96
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G KK+ETLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 43 SNGGRVQCMKVWPPVGKKKYETLSYLPELTEAQLAKEVDYLLRNKWVPC 91
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G K +ETLSYLPPL+ E L K+V+YL+R WVPC Sbjct: 52 SNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLRKGWVPC 100
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 78.2 bits (191), Expect = 6e-15 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLPPLS LL QV YL+ W+PC Sbjct: 52 SNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNKGWIPC 100
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 77.8 bits (190), Expect = 7e-15 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+RCMQVWP +KK+ETLSYLP LS E LL +++YL+++ WVPC Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPC 99
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 77.8 bits (190), Expect = 7e-15 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM VWP G+KKFETLSYLPPLS E+LLK+V YL+ + WVPC Sbjct: 51 SNGGRVQCM-VWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNNGWVPC 98
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 77.4 bits (189), Expect = 1e-14 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 +NGGR+ CMQVWP +KKFETLSYLP LS E+LLK+++YL+ WVPC Sbjct: 49 TNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLLKEINYLLIKGWVPC 97
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 77.4 bits (189), Expect = 1e-14 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G KK+ETLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 48 SNGGRVQCMKVWPPLGKKKYETLSYLPNLTEAQLAKEVDYLLRNKWVPC 96
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 77.4 bits (189), Expect = 1e-14 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CM+VWP G KKFETLSYLP L+ L K+VDYL+R+KW+PC Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWIPC 96
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 77.4 bits (189), Expect = 1e-14 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G KK+ETLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 43 SNGGRVQCMKVWPPLGKKKYETLSYLPDLTEVQLAKEVDYLLRNKWVPC 91
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 77.0 bits (188), Expect = 1e-14 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KK+ETLSYLP L+ E LLK+++YL+ WVPC Sbjct: 50 SNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPC 98
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 77.0 bits (188), Expect = 1e-14 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KK+ETLSYLP L+ E LLK+++YL+ WVPC Sbjct: 50 SNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPC 98
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 76.6 bits (187), Expect = 2e-14 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLP L L K+V+YL+R W+PC Sbjct: 48 SNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPC 96
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 76.6 bits (187), Expect = 2e-14 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLP L L K+V+YL+R W+PC Sbjct: 48 SNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPC 96
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 76.6 bits (187), Expect = 2e-14 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CM+VWP G KKFETLSYLP L+ L K+VDYL+R+KW+PC Sbjct: 48 SNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELGKEVDYLLRNKWIPC 96
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 76.6 bits (187), Expect = 2e-14 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G K++ETLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTESQLAKEVDYLLRNKWVPC 91
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G K++ETLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 48 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTEAQLAKEVDYLLRNKWVPC 96
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP KK+ETLSYLP LS E LL +++YL++S WVPC Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEIEYLLKSGWVPC 98
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP KK+ETLSYLP LS E LL++V+YL+++ WVPC Sbjct: 51 SNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPC 99
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G K++ETLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWVPC 91
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G K++ETLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWVPC 91
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 75.5 bits (184), Expect = 4e-14 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP +KK+ETLSYLP LS E LL +++YL+++ WVPC Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPC 98
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 75.5 bits (184), Expect = 4e-14 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP +KK+ETLSYLP LS E LL +++YL+++ WVPC Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPC 98
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 75.5 bits (184), Expect = 4e-14 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CMQVWP +KK+ETLSYLP LS E LL +++YL+++ WVPC Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPC 98
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 75.5 bits (184), Expect = 4e-14 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLP L L K+V+YL+R W+PC Sbjct: 48 SNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPC 96
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 75.1 bits (183), Expect = 5e-14 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP KK+ETLSYLP LS E LL +V+YL+++ WVPC Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPC 98
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 75.1 bits (183), Expect = 5e-14 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP KK+ETLSYLP LS E LL +V+YL+++ WVPC Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPC 98
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 75.1 bits (183), Expect = 5e-14 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CMQVWP G KKFETLSYLP L L K+V+YL+R W+PC Sbjct: 48 SNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPC 96
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 75.1 bits (183), Expect = 5e-14 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR++CM+VWP G KK+ TLSYLP L+ L K+VDYL+R+KWVPC Sbjct: 43 SNGGRVQCMKVWPPLGKKKYXTLSYLPNLTEAQLAKEVDYLLRNKWVPC 91
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 74.3 bits (181), Expect = 8e-14 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SN G+++CM+VWP G++KFETLSYLP +S E L K+ DYL+R+ WVPC Sbjct: 52 SNAGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPC 100
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 SNGGR+ CM VWP KK+ETLSYLP LS E LLK+++YL++ WVPC Sbjct: 50 SNGGRVECMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPC 98
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +1 Query: 43 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 +NG R+ CMQVW KFETLSYLPPLS +AL KQ+DY+I+S W PC Sbjct: 51 TNGSRVSCMQVWEPYNNLKFETLSYLPPLSQDALAKQIDYVIKSGWAPC 99
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 MQVWP G+KKFETLSYLPPL+TE LL +V+YL+ W+P Sbjct: 1 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIP 40
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 57.0 bits (136), Expect = 1e-08 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = +1 Query: 40 VSNG--GRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 +SNG + R M VW K FET SYLPPL+ + + KQVDY++R+ W PC Sbjct: 25 LSNGTISKSRAMMVWEPFNNKFFETFSYLPPLTDDQITKQVDYILRNNWTPC 76
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 112 SYLPPLSTEALLKQVDYLIRSKWVPC 189 +YLPPLSTEALLKQVDYLIRSKWVPC Sbjct: 1 AYLPPLSTEALLKQVDYLIRSKWVPC 26
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 56.6 bits (135), Expect = 2e-08 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = +1 Query: 7 RLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 R + N G S + + R M VW K FET SYLPPL+ E + KQVDY++ + W P Sbjct: 24 RATKNNKGFASNAAVQKCRDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTP 83 Query: 187 C 189 C Sbjct: 84 C 84
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 55.8 bits (133), Expect = 3e-08 Identities = 26/61 (42%), Positives = 35/61 (57%) Frame = +1 Query: 7 RLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +++ N G S + R M VW K FET SYLPPL+ E + KQVDY++ + W P Sbjct: 25 KVATNKMGFASAVAMKKSREMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTP 84 Query: 187 C 189 C Sbjct: 85 C 85
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 54.3 bits (129), Expect = 9e-08 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Frame = +1 Query: 10 LSGNAAGLGSVSNGGRI--------RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYL 165 + G A ++S GG + R M VW K FET SYLPPL+ E + KQVDY+ Sbjct: 17 VKGGVAPKVAMSRGGFLNSGIMKKDRDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYI 76 Query: 166 IRSKWVPC 189 + + W PC Sbjct: 77 LANSWTPC 84
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/54 (44%), Positives = 31/54 (57%) Frame = +1 Query: 28 GLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 G S + R M VW K FET S+LPPL+ E + KQVDY++ + W PC Sbjct: 31 GFARTSAVNKNRDMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILANSWTPC 84
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M VW K FET SYLPPLS E + QVDY++ + W+PC Sbjct: 46 MMVWTPVNNKMFETFSYLPPLSDEQIAAQVDYIVANGWIPC 86
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 53.1 bits (126), Expect = 2e-07 Identities = 25/54 (46%), Positives = 32/54 (59%) Frame = +1 Query: 28 GLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 G + S + R M VW K FET SYLPPL+ E + KQVDY++ + W PC Sbjct: 30 GFVNTSAAIKNREMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANAWTPC 83
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 53.1 bits (126), Expect = 2e-07 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = +1 Query: 61 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 R M VW K FET SYLPPL+ E + KQVDY++ + W PC Sbjct: 41 REMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTPC 83
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M VW K FET SYLPPL+ E + QVDY++ + W+PC Sbjct: 46 MMVWTPVNNKMFETFSYLPPLTDEQIAAQVDYIVANGWIPC 86
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 51.6 bits (122), Expect = 6e-07 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +1 Query: 61 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 R M VW K FET S+LPPL+ E + KQVDY++ + W PC Sbjct: 41 REMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILANSWTPC 83
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 51.6 bits (122), Expect = 6e-07 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +1 Query: 61 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 R M VW K FET S+LPPL+ E + KQVDY++ + W PC Sbjct: 41 REMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILTNSWTPC 83
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 51.6 bits (122), Expect = 6e-07 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +1 Query: 61 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 R M VW K FET S+LPPL+ E + KQVDY++ + W PC Sbjct: 32 REMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILTNSWTPC 74
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 51.2 bits (121), Expect = 7e-07 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +1 Query: 61 RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 R M VW K FET S+LPPL+ E + KQVDY++ + W PC Sbjct: 41 RGMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILINSWTPC 83
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 48.9 bits (115), Expect = 4e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +1 Query: 70 QVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 +VW K++ET SYLPPL+ + + +QVDY+I + W PC Sbjct: 30 KVWQPVNNKQYETFSYLPPLTNQKIGRQVDYIINNGWTPC 69
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 48.5 bits (114), Expect = 5e-06 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = +1 Query: 7 RLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 R SG+++ G + G + M+VW KKFET SYLPPLS + KQVD +I P Sbjct: 690 RPSGSSSSWGMAAMTGE-KDMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSP 748 Query: 187 C 189 C Sbjct: 749 C 749 Score = 48.5 bits (114), Expect = 5e-06 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = +1 Query: 7 RLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 R SG+++ G + G + M+VW KKFET SYLPPLS + KQVD +I P Sbjct: 403 RPSGSSSSWGMAAMTGE-KDMKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSP 461 Query: 187 C 189 C Sbjct: 462 C 462 Score = 45.4 bits (106), Expect = 4e-05 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M+VW KKFET SYLPPLS + KQVD +I PC Sbjct: 1141 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSPC 1181 Score = 45.4 bits (106), Expect = 4e-05 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M+VW KKFET SYLPPLS + KQVD +I PC Sbjct: 997 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSPC 1037 Score = 45.4 bits (106), Expect = 4e-05 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M+VW KKFET SYLPPLS + KQVD +I PC Sbjct: 854 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSPC 894 Score = 45.4 bits (106), Expect = 4e-05 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M+VW KKFET SYLPPLS + KQVD +I PC Sbjct: 566 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSPC 606 Score = 45.4 bits (106), Expect = 4e-05 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M+VW KKFET SYLPPLS + KQVD +I PC Sbjct: 279 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSPC 319 Score = 45.4 bits (106), Expect = 4e-05 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPC 189 M+VW KKFET SYLPPLS + KQVD +I PC Sbjct: 135 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMIIAKGLSPC 175
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 42.4 bits (98), Expect = 3e-04 Identities = 14/31 (45%), Positives = 26/31 (83%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +++ETLSYLPPLS + + +Q++Y++R ++P Sbjct: 8 RRYETLSYLPPLSDQQIARQIEYMVREGYIP 38
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 41.2 bits (95), Expect = 8e-04 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +1 Query: 112 SYLPPLSTEALLKQVDYLIRSKWVPC 189 SYLPPL+ E + KQVDY++ + W PC Sbjct: 2 SYLPPLTDEQISKQVDYILANSWTPC 27
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 K+FET SYLP +S E + KQ++Y++ W P Sbjct: 24 KRFETFSYLPQMSAEEIRKQIEYIVSKGWNP 54
>RBS_ALVHS (P24682) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 121 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +KFET SYLP L E + KQV+Y++ W P Sbjct: 17 RKFETFSYLPELGVEKIRKQVEYIVSKGWNP 47
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/31 (48%), Positives = 24/31 (77%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 K++ETLSYLPPLS + + +QV Y++ ++P Sbjct: 8 KRYETLSYLPPLSDQQIARQVQYMMDQGYIP 38
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 38.5 bits (88), Expect = 0.005 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 MQ P E +++ETLSYLPPL+ + KQV Y++ ++P Sbjct: 1 MQTLPKE--RRYETLSYLPPLTDVQIEKQVQYILSQGYIP 38
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 38.5 bits (88), Expect = 0.005 Identities = 14/31 (45%), Positives = 25/31 (80%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +++ETLSYLPPL+ + + KQV++L+ ++P Sbjct: 8 RRYETLSYLPPLTDQQIAKQVEFLLDQGFIP 38
>RBS_THIDA (Q56260) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 118 Score = 37.7 bits (86), Expect = 0.008 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +KFET SYLP ++ + KQV+YL+ W P Sbjct: 17 RKFETFSYLPAMNAADIRKQVEYLVSKGWNP 47
>RBS1_CHRVI (P22850) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 37.7 bits (86), Expect = 0.008 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +KFET SYLP + + + KQV+Y++ W P Sbjct: 16 RKFETFSYLPRMDADRIRKQVEYIVSKGWNP 46
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 37.0 bits (84), Expect = 0.014 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +1 Query: 97 KFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 KFETLSYLP L+ + + +QV Y++ W P Sbjct: 18 KFETLSYLPALTADEIRQQVAYIVSKGWNP 47
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 37.0 bits (84), Expect = 0.014 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +1 Query: 91 IKKFETLSYLPPLSTEALLKQVDYLIRSKW 180 I ++ET SYLPPL+ E +L+Q+ Y++ + W Sbjct: 13 IGRYETFSYLPPLNREEILEQILYILDNGW 42
>RBS_THINE (P45686) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 36.6 bits (83), Expect = 0.019 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 97 KFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 K+ET SYLPP++ E + Q+ Y I W P Sbjct: 12 KYETFSYLPPMNAERIRAQIKYAIAQGWSP 41
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 35.8 bits (81), Expect = 0.032 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 ++FET SYLPPLS + Q++Y+I + P Sbjct: 9 RRFETFSYLPPLSDRQIAAQIEYMIEQGFHP 39
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 35.4 bits (80), Expect = 0.042 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 67 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 M V +KK+ET SYLP ++ E + +Q+ + I W P Sbjct: 1 MAVQAYRSLKKYETFSYLPQMTPEQVRRQIAHAIAQGWNP 40
>RBS1_THIFE (P28896) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 110 Score = 35.4 bits (80), Expect = 0.042 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 97 KFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 K+ET SYLP + E + +Q+ YLI W P Sbjct: 12 KYETFSYLPAMGPEKMRRQIAYLINQGWNP 41
>RBS1_HYDMR (Q59459) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 35.4 bits (80), Expect = 0.042 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +K ET SYLP ++T+ + QV+Y+I W P Sbjct: 17 RKAETFSYLPKMTTDQIKAQVEYIISKGWNP 47
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 35.0 bits (79), Expect = 0.055 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +KFET SYLPPL+ + + +Q+ Y + + + P Sbjct: 7 RKFETFSYLPPLNDQQIARQLQYALSNGYSP 37
>RBS_RHOCA (O32741) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 118 Score = 33.1 bits (74), Expect = 0.21 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +1 Query: 94 KKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 +K T SYLPP+ + +QV++++++ W P Sbjct: 17 RKMGTFSYLPPMGEAEIRRQVEWIVKNGWNP 47
>RBS_SYNPX (P0A4S5) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.4 bits (67), Expect = 1.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 91 IKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 + ET +LPP++ + + Q+ Y+I W P Sbjct: 13 VATLETFGFLPPMTQDEIYDQIAYIIAQGWSP 44
>RBS_SYNPW (P0A4S6) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.4 bits (67), Expect = 1.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 91 IKKFETLSYLPPLSTEALLKQVDYLIRSKWVP 186 + ET +LPP++ + + Q+ Y+I W P Sbjct: 13 VATLETFGFLPPMTQDEIYDQIAYIIAQGWSP 44
>RBS_GALSU (P23756) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 106 TLSYLPPLSTEALLKQVDYLIRSK 177 T S+LP L+ E + KQ+DY+I K Sbjct: 7 TFSFLPDLTDEQIKKQIDYMISKK 30
>NAS35_CAEEL (P98060) Zinc metalloproteinase nas-35 precursor (EC 3.4.24.21)| (Nematode astacin 35) (Dumpy protein 31) (Tollish protein 2) Length = 592 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 186 RHPLGADQVVDLLQECLR 133 RHPLG +Q+V L EC+R Sbjct: 199 RHPLGEEQLVSLAPECIR 216
>RBS2_HYDMR (Q59461) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 122 Score = 28.9 bits (63), Expect = 3.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 103 ETLSYLPPLSTEALLKQVDYLIRSKWVP 186 ET S+LP + + + Q+ Y+I W P Sbjct: 15 ETFSFLPEFTADEIYDQIVYIINQGWTP 42
>RBS_PORAE (Q09125) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 106 TLSYLPPLSTEALLKQVDYLIRSKW 180 T S+LP L+ + KQV Y + KW Sbjct: 7 TFSFLPDLTDAQIQKQVQYAVSKKW 31
>RBS_OLILU (P14961) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 139 Score = 28.1 bits (61), Expect = 6.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 112 SYLPPLSTEALLKQVDYLIRSKW 180 SYLP L+ ++KQ+DY + W Sbjct: 9 SYLPDLTDAQIIKQIDYCLSRGW 31
>RBS_GUITH (P14960) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 139 Score = 28.1 bits (61), Expect = 6.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 112 SYLPPLSTEALLKQVDYLIRSKW 180 S+LP L+ E ++KQ+ Y I W Sbjct: 9 SFLPDLTDEQIVKQIQYAISKNW 31
>RBS_CYAME (O22024) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 106 TLSYLPPLSTEALLKQVDYLIRSKW 180 T YLP L+ E + KQ+ Y I W Sbjct: 7 TFCYLPDLTDEQIRKQIQYAINQGW 31
>RBS_CYACA (P37394) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 27.7 bits (60), Expect = 8.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 106 TLSYLPPLSTEALLKQVDYLIRSKW 180 T S+LP L+ + + KQ+ Y I W Sbjct: 7 TFSFLPDLTNDQIRKQIQYAINKGW 31
>RBS_ANTSP (P25458) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 27.7 bits (60), Expect = 8.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 106 TLSYLPPLSTEALLKQVDYLIRSKW 180 T S+LP L+ E + KQ+ Y + W Sbjct: 7 TFSFLPDLTDEQIKKQIAYAVSQNW 31
>HHEX_CHICK (Q05502) Homeobox protein PRH (Hematopoietically expressed| homeobox) Length = 277 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 49 GGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLK 150 GG++R IE KKFET YL P + L K Sbjct: 146 GGQVRFSNEQTIELEKKFETQKYLSPPERKRLAK 179
>HHEX_HUMAN (Q03014) Homeobox protein PRH (Hematopoietically expressed| homeobox) (Homeobox protein HEX) Length = 270 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 49 GGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQV 156 GG++R IE KKFET YL P + L K + Sbjct: 139 GGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKML 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,393,310 Number of Sequences: 219361 Number of extensions: 301460 Number of successful extensions: 1264 Number of sequences better than 10.0: 135 Number of HSP's better than 10.0 without gapping: 1234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
