| Clone Name | baal20a19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ALFC_ORYSA (Q40677) Fructose-bisphosphate aldolase, chloroplast ... | 57 | 1e-08 |
|---|
>ALFC_ORYSA (Q40677) Fructose-bisphosphate aldolase, chloroplast precursor (EC| 4.1.2.13) (ALDP) Length = 388 Score = 57.0 bits (136), Expect = 1e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 26 MASATLLKSSFLPKKAEWGATRQAXXPKPM 115 MASATLLKSSFLPKK+EWGATRQA PKP+ Sbjct: 1 MASATLLKSSFLPKKSEWGATRQAAAPKPV 30 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,559,977 Number of Sequences: 219361 Number of extensions: 173915 Number of successful extensions: 580 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 80,573,946 effective HSP length: 13 effective length of database: 77,722,253 effective search space used: 1865334072 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)