| Clone Name | baal19n22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IAAS_HORVU (P07596) Alpha-amylase/subtilisin inhibitor precursor... | 32 | 1.1 | 2 | RL16_MYCGE (P47404) 50S ribosomal protein L16 | 30 | 4.0 | 3 | RL16_MYCPN (P41204) 50S ribosomal protein L16 | 30 | 5.3 | 4 | NUKM_TRYBB (Q26783) NADH-ubiquinone oxidoreductase 20 kDa subuni... | 30 | 5.3 | 5 | SHAN3_HUMAN (Q9BYB0) SH3 and multiple ankyrin repeat domains pro... | 30 | 6.9 |
|---|
>IAAS_HORVU (P07596) Alpha-amylase/subtilisin inhibitor precursor (BASI)| Length = 203 Score = 32.3 bits (72), Expect = 1.1 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +3 Query: 399 WFLCLGGRSHGGYLVLAPGSPPLCAGVLLCLHLSSDPTTWHNVLPARI 542 +++ R+HGG L +APG C L +S DP H+ P RI Sbjct: 42 YYVLSANRAHGGGLTMAPGHGRHCP-----LFVSQDPNGQHDGFPVRI 84
>RL16_MYCGE (P47404) 50S ribosomal protein L16| Length = 138 Score = 30.4 bits (67), Expect = 4.0 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 14 TRGSWICARTFRSARPASRICC*FDASRRIRLFPAVS 124 T+G+WI AR SAR A C IR+FP +S Sbjct: 37 TKGNWIDARAIESARVAISKCLGKTGKMWIRIFPHMS 73
>RL16_MYCPN (P41204) 50S ribosomal protein L16| Length = 139 Score = 30.0 bits (66), Expect = 5.3 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 14 TRGSWICARTFRSARPASRICC*FDASRRIRLFPAVS 124 T+G+WI AR SAR A C IR+FP +S Sbjct: 37 TKGNWIDARAIESARIAISKCLGKTGKMWIRIFPHMS 73
>NUKM_TRYBB (Q26783) NADH-ubiquinone oxidoreductase 20 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-20KD) (CI-20KD) Length = 202 Score = 30.0 bits (66), Expect = 5.3 Identities = 16/62 (25%), Positives = 24/62 (38%), Gaps = 18/62 (29%) Frame = +3 Query: 396 RWFLCLGGRSHGG------YLVLA------------PGSPPLCAGVLLCLHLSSDPTTWH 521 +W + +G ++GG Y VL PG PP ++ CLH WH Sbjct: 134 KWVISMGSCANGGGYYHFSYAVLRGCERAIPVDFWIPGCPPSAESLVFCLHTLQKKIRWH 193 Query: 522 NV 527 + Sbjct: 194 EI 195
>SHAN3_HUMAN (Q9BYB0) SH3 and multiple ankyrin repeat domains protein 3 (Shank3)| (Proline-rich synapse-associated protein 2) (ProSAP2) (Fragment) Length = 797 Score = 29.6 bits (65), Expect = 6.9 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -3 Query: 510 SDQRRGADKGAHQHTRGENPGLKQDNP-----RAISPRDTKTIFITVVACHASAP 361 S RG G + G+ PGL P R + R T+F++V A SAP Sbjct: 52 SPTHRGPRPGGLDYGAGDGPGLAFGGPGPAKDRRLEERRRSTVFLSVGAIEGSAP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,841,806 Number of Sequences: 219361 Number of extensions: 1844773 Number of successful extensions: 4641 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4637 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)