ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal19k13 |
|---|---|
| Clone Library Name | barley_pub |
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +3 Query: 21 MLTVCIKWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDD 182 + +V +KW K+ F G+E++T +PP+VFK QL+ LTGV P RQK+MVKGG LKDD Sbjct: 2 LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDD 55
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +3 Query: 21 MLTVCIKWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDD 182 + +V +KW K+ F G+E++T +PP+VFK QL+ LTGV P RQK+MVKGG LKDD Sbjct: 2 LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDD 55
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +3 Query: 21 MLTVCIKWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDD 182 + +V +KW K+ F G+E++T +PP+VFK QL+ LTGV P RQK+MVKGG LKDD Sbjct: 2 LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDD 55
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 74.7 bits (182), Expect = 6e-14 Identities = 31/54 (57%), Positives = 43/54 (79%) Frame = +3 Query: 21 MLTVCIKWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDD 182 + +V +KW K+ F G+E++T +PP+VFK QL+ LTGV P RQ++MVKGG LKDD Sbjct: 2 LYSVTVKWGKEKFGGVELNTDEPPMVFKAQLFALTGVQPARQRVMVKGGTLKDD 55
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 60.8 bits (146), Expect = 9e-10 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +3 Query: 21 MLTVCIKWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDD 182 M V +KWQK+ + +E+DTS PP+VFK QL+ LT V PERQK+++ G L DD Sbjct: 1 MPIVNVKWQKEKYV-VEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDD 53
>UBP6_SCHPO (Q92353) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thiolesterase 6) (Ubiquitin-specific processing protease 6) (Deubiquitinating enzyme 6) Length = 467 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = +3 Query: 21 MLTVCIKWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDD 182 M+ + I+WQ + + +EI+ ++ K QLY+LT VPPERQK++VKGG LKDD Sbjct: 1 MIPIAIRWQGKKYD-LEIEPNETGSTLKHQLYSLTQVPPERQKVIVKGGQLKDD 53
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 32.0 bits (71), Expect = 0.46 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +3 Query: 36 IKWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDDT 185 I+ +V+P I + T K++ LT VP RQK MVKGG+ +++ Sbjct: 10 IRHSGKVYP-ITLSTDATSADLKSKAEELTQVPSARQKYMVKGGLSGEES 58
>DSK2_YEAST (P48510) Ubiquitin domain-containing protein DSK2| Length = 373 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +3 Query: 39 KWQKQVFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDD 182 KW+ V P + + FK + G+P Q+++ G ILKDD Sbjct: 13 KWEVNVAPESTV------LQFKEAINKANGIPVANQRLIYSGKILKDD 54
>RAD23_ORYSA (Q40742) Putative DNA repair protein RAD23 (OsRAD23)| Length = 392 Score = 28.9 bits (63), Expect = 3.9 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +3 Query: 66 IEIDTSQPPVVFKTQLYTLTG---VPPERQKIMVKGGILKDDT 185 IE+D++Q K + T G P E+Q ++ +G +LKDDT Sbjct: 15 IEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDT 57
>ISPE_NOVAD (Q2G7F1) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 285 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 103 LKTTGGWLVSISMPGKTCF 47 L+ TGGWL +S G TCF Sbjct: 239 LRQTGGWLTRMSGSGATCF 257
>TBCB_YEAST (P53904) Tubulin-specific chaperone B (Tubulin folding cofactor B)| (Alpha-tubulin formation protein 1) Length = 254 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 99 FKTQLYTLTGVPPERQKIMVK 161 FK +LY +TGV PE +I+VK Sbjct: 26 FKDRLYHVTGVEPEDMEIVVK 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,111,574 Number of Sequences: 219361 Number of extensions: 537508 Number of successful extensions: 1464 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1464 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
