| Clone Name | baal19j24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FPS_FUJSV (P00530) Tyrosine-protein kinase transforming protein ... | 27 | 10.0 |
|---|
>FPS_FUJSV (P00530) Tyrosine-protein kinase transforming protein FPS (EC| 2.7.10.2) Length = 873 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 6 LVSTRGTIQAFRAMLADALPDAKVVEPTPGVPL 104 LV + +QA R MLA+ L + EP P +PL Sbjct: 423 LVCAQAKLQAQRDMLANKLAELGSEEPPPALPL 455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,352,152 Number of Sequences: 219361 Number of extensions: 354323 Number of successful extensions: 1489 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1467 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)