| Clone Name | baal18n04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y046_CLOPE (Q8XPB9) UPF0133 protein CPE0046 | 36 | 0.031 | 2 | Y4556_STRAW (Q82EQ8) UPF0133 protein SAV4556 | 29 | 2.9 | 3 | Y3619_STRCO (Q9XAI3) UPF0133 protein SCO3619 | 29 | 3.8 | 4 | Y808_CHLPN (Q9Z798) Protein CPn_0808/CP1063/CPj0808/CpB0837 | 29 | 3.8 | 5 | Y3498_GLOVI (Q7NFM6) UPF0133 protein glr3498 | 29 | 3.8 |
|---|
>Y046_CLOPE (Q8XPB9) UPF0133 protein CPE0046| Length = 112 Score = 35.8 bits (81), Expect = 0.031 Identities = 21/48 (43%), Positives = 31/48 (64%) Frame = +1 Query: 67 AKGGIFGNIGNMQNLYETVKKAQMVVQVEAVRVQKELAATEIEGYCEG 210 A+GG G +GNM NL +K+AQM +Q + +Q+E+ A+E EG G Sbjct: 2 ARGGFPGGMGNMNNL---MKQAQM-LQKQMQSMQEEIEASEFEGSAGG 45
>Y4556_STRAW (Q82EQ8) UPF0133 protein SAV4556| Length = 113 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 94 GNMQNLYETVKKAQMVVQVEAVRVQKELAATEIEGYCEGEL 216 G N+ + +++AQ + Q + Q+ELA TE+EG G L Sbjct: 5 GGQPNMQQLLQQAQKMQQ-DLANAQEELARTEVEGQAGGGL 44
>Y3619_STRCO (Q9XAI3) UPF0133 protein SCO3619| Length = 115 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 94 GNMQNLYETVKKAQMVVQVEAVRVQKELAATEIEGYCEGEL 216 G N+ + +++AQ + Q + + Q+ELA TE++G G L Sbjct: 5 GGQPNMQQLLQQAQKMQQ-DLAKAQEELARTEVDGQAGGGL 44
>Y808_CHLPN (Q9Z798) Protein CPn_0808/CP1063/CPj0808/CpB0837| Length = 444 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 67 AKGGIFGNIGNMQNLYETVKKAQMVVQVEAVRV 165 A GG+FG + N N E V + VV+ + RV Sbjct: 310 ASGGLFGEVLNKPNWSEKVSRGMNVVKTQGARV 342
>Y3498_GLOVI (Q7NFM6) UPF0133 protein glr3498| Length = 111 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 82 FGNIGNMQNLYETVKKAQMVVQVEAVRVQKELAATEIEGYCEGEL 216 FG +G Q + VK+ +Q + ++Q ELAA IEG G L Sbjct: 5 FGPMGQFQEALKRVKQ----IQEGSAKLQDELAALSIEGVAGGGL 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.134 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,707,876 Number of Sequences: 219361 Number of extensions: 316595 Number of successful extensions: 1431 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1431 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)