| Clone Name | baal18l19 |
|---|---|
| Clone Library Name | barley_pub |
>CDC20_MOUSE (Q9JJ66) Cell division cycle protein 20 homolog (p55CDC) (mmCdc20)| Length = 499 Score = 29.3 bits (64), Expect = 2.9 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = +3 Query: 48 APLARWQR----TTRPRPTICLITIRSSSG--ISCRLPSRSSSEVRAT 173 AP+ARWQR T P P+ RS S R P +SSS+V+ T Sbjct: 23 APVARWQRKAKEATGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTT 70
>RBP2_BOVIN (P48820) Ran-binding protein 2 (RanBP2) (Nuclear pore complex| protein Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) (Fragment) Length = 1085 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 175 DVALTSEEERDGRRHE--IPDEDLIVIKHMVGRGRVVRCHRA 56 D +T EEERDG+ E +P DL+ + +VV HRA Sbjct: 161 DSDVTQEEERDGQHFEPVVPLPDLVEVSSGEENEQVVFSHRA 202
>CDC20_RAT (Q62623) Cell division cycle protein 20 homolog (p55CDC)| Length = 499 Score = 28.5 bits (62), Expect = 5.0 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = +3 Query: 48 APLARWQR----TTRPRPTICLITIRSSSG--ISCRLPSRSSSEVRAT 173 AP+ARWQR T P P+ RS S R P +S+S+V+ T Sbjct: 23 APIARWQRKAKEATGPAPSPMRAANRSHSAGRTPGRTPGKSNSKVQTT 70
>PROB_SHEON (Q8EHU2) Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase)| (GK) Length = 372 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 23 RAVVNYCGSAVGTVAANDPSTANHMLNYD 109 R + YCG A+G +A +L YD Sbjct: 330 RGITRYCGEALGLIAGKHSDEIESVLGYD 358
>RHLA_PSEAE (Q51559) Rhamnosyltransferase 1 subunit A (EC 2.4.1.-)| Length = 295 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 17 LNRAVVNYCGSAVGTVAANDPSTANHMLN 103 LN+A+++Y G A + +D S H+LN Sbjct: 131 LNQAMLDYVGRAQALIELDDKSAIGHLLN 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,112,883 Number of Sequences: 219361 Number of extensions: 456655 Number of successful extensions: 1380 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1380 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)