| Clone Name | baal18h05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIMK_RHOBA (Q7UNW8) Ribosomal protein S6 modification protein | 30 | 1.9 | 2 | ACKA1_NEIMB (Q9JYM1) Acetate kinase 1 (EC 2.7.2.1) (Acetokinase 1) | 28 | 4.3 | 3 | ACKA1_NEIMA (Q9JTM0) Acetate kinase 1 (EC 2.7.2.1) (Acetokinase 1) | 28 | 4.3 | 4 | RIMK_COXBU (Q83BB0) Ribosomal protein S6 modification protein | 28 | 5.6 |
|---|
>RIMK_RHOBA (Q7UNW8) Ribosomal protein S6 modification protein| Length = 405 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 6/73 (8%) Frame = +3 Query: 105 LTFGPHVVYYSATPLSEYDTIGTSVKAAVVYXGAALVK------LVCLATFLKVPDANDS 266 L G +YY + LS+YD + + A++ Y G A+V+ + C + + ++ D Sbjct: 41 LAEGEPDLYYRSKQLSDYDGVLPRIGASITYFGTAVVRQFEQMDVFCANSSAGISNSRDK 100 Query: 267 FDPYQEIMKILIG 305 Q + + IG Sbjct: 101 LRSLQILSRHQIG 113
>ACKA1_NEIMB (Q9JYM1) Acetate kinase 1 (EC 2.7.2.1) (Acetokinase 1)| Length = 398 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 171 TSVKAAVVYXGAALVKLVCLATFLKVPDANDSFDPYQEIMKI 296 +S+K AV+ G+ V L CLA L +PDA +F E K+ Sbjct: 14 SSLKGAVLDNGSGEVLLSCLAEKLNLPDAYITFKVNGEKHKV 55
>ACKA1_NEIMA (Q9JTM0) Acetate kinase 1 (EC 2.7.2.1) (Acetokinase 1)| Length = 398 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 171 TSVKAAVVYXGAALVKLVCLATFLKVPDANDSFDPYQEIMKI 296 +S+K AV+ G+ V L CLA L +PDA +F E K+ Sbjct: 14 SSLKGAVLDNGSGEVLLSCLAEKLNLPDAYITFKVNGEKHKV 55
>RIMK_COXBU (Q83BB0) Ribosomal protein S6 modification protein| Length = 301 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/82 (20%), Positives = 34/82 (41%), Gaps = 6/82 (7%) Frame = +3 Query: 126 VYYSATPLSEYDTIGTSVKAAVVYXGAALVK------LVCLATFLKVPDANDSFDPYQEI 287 ++Y L+ YD + + A++ + G A+V+ CL + + + + D F Q Sbjct: 48 IHYMGKELARYDAVIPRIGASITFYGTAVVRQFEMMGTFCLNSSMSITRSRDKFRSLQ-- 105 Query: 288 MKILIGFIDVAGLYFALTQLTH 353 F+ G+ +T H Sbjct: 106 ------FLSRKGIDLPITGFAH 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,986,718 Number of Sequences: 219361 Number of extensions: 427650 Number of successful extensions: 866 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)