| Clone Name | baal18e04 |
|---|---|
| Clone Library Name | barley_pub |
>RDRP_BDV (P52639) Large structural protein (L protein) (P180) [Includes:| RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 1711 Score = 30.0 bits (66), Expect = 2.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 267 SCGFYGREVALRGASFPDWLSLV 335 +C R V LR A +PDWLSLV Sbjct: 838 TCSLVNRVVKLRIAPYPDWLSLV 860
>RL4_PYRAE (Q8ZW51) 50S ribosomal protein L4P| Length = 283 Score = 28.9 bits (63), Expect = 6.3 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 12/65 (18%) Frame = +2 Query: 137 AELHLLGPY--PLVRRAALPPSAAK----------GEGHSWRG**VRLIIAWVKEFLWFL 280 A LH L P L+RRA L +A+ G+ HS V L IA + + L Sbjct: 44 APLHFLEPIRPDLIRRAYLSALSARFQPKGVYEGAGKEHSCESFGVGLGIARIPRYKGSL 103 Query: 281 WPRSC 295 WPR C Sbjct: 104 WPRGC 108
>R13L1_ARATH (Q9LRR4) Putative disease resistance RPP13-like protein 1| Length = 1054 Score = 28.5 bits (62), Expect = 8.2 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = +3 Query: 300 RGASFPDWLS------LVVARRREELGHPHCYSFPPLGVIP 404 +G FPDWLS +V R RE +C S P LG +P Sbjct: 776 KGRRFPDWLSDPSFSRIVCIRLRE---CQYCTSLPSLGQLP 813
>VST2_HEVPA (P33426) Structural protein 2 precursor| Length = 660 Score = 28.5 bits (62), Expect = 8.2 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = +3 Query: 171 FAAPLSPLLP-QRGRDTH---GEASKY 239 +AAPLSPLLP Q G +TH EAS Y Sbjct: 156 YAAPLSPLLPLQDGTNTHIMATEASNY 182
>VST2_HEVMY (Q04611) Structural protein 2 precursor| Length = 660 Score = 28.5 bits (62), Expect = 8.2 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = +3 Query: 171 FAAPLSPLLP-QRGRDTH---GEASKY 239 +AAPLSPLLP Q G +TH EAS Y Sbjct: 156 YAAPLSPLLPLQDGTNTHIMATEASNY 182
>VST2_HEVBU (P29326) Structural protein 2 precursor| Length = 660 Score = 28.5 bits (62), Expect = 8.2 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = +3 Query: 171 FAAPLSPLLP-QRGRDTH---GEASKY 239 +AAPLSPLLP Q G +TH EAS Y Sbjct: 156 YAAPLSPLLPLQDGTNTHIMATEASNY 182
>VST2_HEVRH (Q00270) Structural protein 2 (Fragment)| Length = 485 Score = 28.5 bits (62), Expect = 8.2 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = +3 Query: 171 FAAPLSPLLP-QRGRDTH---GEASKY 239 +AAPLSPLLP Q G +TH EAS Y Sbjct: 24 YAAPLSPLLPLQDGTNTHIMATEASNY 50
>TOPRS_DROME (Q9V8P9) Ubiquitin-protein E3 ligase Topors (EC 6.3.2.-)| (SUMO1-protein E3 ligase Topors) (Topoisomerase I-binding RING finger protein) (Topoisomerase I-binding arginine/serine-rich protein) (dTopors) Length = 1038 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 400 MTPSGGNE*QWGCPSSSRRRATTKLNQSGKEAPRRATS 287 MTPS + + GC + RRR+ + NQS + A ++S Sbjct: 819 MTPSPREDNEPGCSAPKRRRSCSHSNQSSQSASLASSS 856 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,930,343 Number of Sequences: 219361 Number of extensions: 1060854 Number of successful extensions: 2395 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2394 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)