| Clone Name | baal17n24 |
|---|---|
| Clone Library Name | barley_pub |
>BRE1_CANGA (Q6FWF3) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 693 Score = 31.6 bits (70), Expect = 2.0 Identities = 22/101 (21%), Positives = 43/101 (42%), Gaps = 1/101 (0%) Frame = +3 Query: 228 LEEIRQKRAAERMQQQQTPAATASH-GDPHGNQRAAAELLARVXXXXXXXXXXXXXXXML 404 +EE+ + + QT ++ + H N+ +LL ++ Sbjct: 270 IEELENYKQLNEKELAQTRLEISNLLSEKHSNEEEREDLLHQIEKLKASNTDLTLTNESF 329 Query: 405 MSKFAEKEVEKDSLVSRLNDLEKNVVPSLKKSLNDISLEKD 527 +SKF E EKD+ +++ + + SLK +++LEKD Sbjct: 330 LSKFQELAKEKDTFQEKISSDFEKTLESLK--AQNLALEKD 368
>XAG2_XENLA (P55869) Probable secreted protein XAG-2 precursor (Secreted| protein np77) Length = 185 Score = 31.2 bits (69), Expect = 2.6 Identities = 19/61 (31%), Positives = 24/61 (39%) Frame = -3 Query: 283 GVCCCCILSAALFCRISSSCHTRNRDRSLGHQKLTGEARRGSEPPPASRKGKKVKSGGWR 104 G+ C++ L C + R R G G A+ SEP P KG K GW Sbjct: 4 GLSLACLV---LLCSVLGEAALRKPKRQAGATDTNGAAK--SEPAPVKTKGLKTLDRGWG 58 Query: 103 E 101 E Sbjct: 59 E 59
>HIP1_HUMAN (O00291) Huntingtin-interacting protein 1 (HIP-I)| Length = 1030 Score = 30.0 bits (66), Expect = 5.8 Identities = 19/60 (31%), Positives = 36/60 (60%) Frame = +3 Query: 408 SKFAEKEVEKDSLVSRLNDLEKNVVPSLKKSLNDISLEKDAAVIAKEDALAQLRSMKKRL 587 ++FAE E E+DSLVS E+ + +L+K L D L+ + + E+++ QL ++++ Sbjct: 561 AEFAELEKERDSLVSGAAHREEE-LSALRKELQDTQLK----LASTEESMCQLAKDQRKM 615
>TWST1_PONPY (Q8MIB9) Twist-related protein 1| Length = 203 Score = 30.0 bits (66), Expect = 5.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 157 EPPPASRKGKKVKSGGWREAYGAAAPGG 74 +PP R G+K +S R A G A PGG Sbjct: 28 QPPSGKRGGRKRRSSSRRSAGGGAGPGG 55
>CLPB_CHLMU (Q9PKS5) Chaperone clpB| Length = 867 Score = 29.6 bits (65), Expect = 7.6 Identities = 12/31 (38%), Positives = 23/31 (74%) Frame = +3 Query: 411 KFAEKEVEKDSLVSRLNDLEKNVVPSLKKSL 503 KFAE+E E+ + +R+ +L +++PSL+K + Sbjct: 482 KFAEEEAERTADYNRVAELRYSLIPSLEKEI 512
>BRE1_DEBHA (Q6BWW6) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 691 Score = 29.6 bits (65), Expect = 7.6 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Frame = +3 Query: 408 SKFAEKEVEKDS-LVSRLNDLEKNV---VPSLKKSLNDISLEKDAAVIAKEDALAQLRSM 575 +K + ++ K LVS+LNDLEK+ + L KS ND + + +A+ LR++ Sbjct: 499 NKILKTQINKSQELVSKLNDLEKSYLDKIEILTKSNNDFKIIRQSALQENSKLQESLRAI 558 Query: 576 KKR 584 R Sbjct: 559 DVR 561
>SORC1_HUMAN (Q8WY21) VPS10 domain-containing receptor SorCS1 precursor (hSorCS)| Length = 1168 Score = 29.3 bits (64), Expect = 9.9 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 22 PSSRPGRSIARRDGVSPRLQGPPHRTPPSTPR 117 PS++PG S S RLQ H TPPSTP+ Sbjct: 1134 PSTQPGDS-------SLRLQRARHATPPSTPK 1158
>Y1882_ARCFU (O28397) Hypothetical protein AF1882 precursor| Length = 198 Score = 29.3 bits (64), Expect = 9.9 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Frame = -1 Query: 522 SPVRCHLETSSTRALHFSR-GHLIG*PGNPFQLPSQQTWTSAF-----GFPSPIP 376 SPV+ HL S R+L F R GH+ Q+ Q T+ S F +PSP+P Sbjct: 103 SPVQRHLSISIFRSLPFLRMGHMT-------QMAGQATFQSPFSGASLSYPSPLP 150
>SMBT2_HUMAN (Q5VUG0) Scm-like with four MBT domains protein 2| Length = 894 Score = 29.3 bits (64), Expect = 9.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 19 LPSSRPGRSIARRDGVSPRLQGPPHRT 99 +PS+RP R++ R G P + PP RT Sbjct: 752 VPSARPRRAVTLRSGSEPVRRPPPERT 778
>MYH9_CHICK (P14105) Myosin-9 (Myosin heavy chain, nonmuscle IIa) (Nonmuscle| myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) (Cellular myosin heavy chain, type A) (Nonmuscle myosin heavy chain-A) (NMMHC-A) Length = 1959 Score = 29.3 bits (64), Expect = 9.9 Identities = 24/123 (19%), Positives = 49/123 (39%) Frame = +3 Query: 219 VWQLEEIRQKRAAERMQQQQTPAATASHGDPHGNQRAAAELLARVXXXXXXXXXXXXXXX 398 + LEE + R E+ +Q+ GD AEL A++ Sbjct: 1029 ITDLEE--RLRREEKQRQELEKTRRKLEGDSSDLHDQIAELQAQIAELKIQLSKKEEELQ 1086 Query: 399 MLMSKFAEKEVEKDSLVSRLNDLEKNVVPSLKKSLNDISLEKDAAVIAKEDALAQLRSMK 578 +++ E+ +K+ + ++ +LE + L++ L ++ A K D +L ++K Sbjct: 1087 AALARVEEEAAQKNMALKKIRELESQIT-ELQEDLESERASRNKAEKQKRDLGEELEALK 1145 Query: 579 KRL 587 L Sbjct: 1146 TEL 1148 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,325,607 Number of Sequences: 219361 Number of extensions: 1536791 Number of successful extensions: 6031 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6008 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)