| Clone Name | baal17l21 |
|---|---|
| Clone Library Name | barley_pub |
>POL_MMTVB (P03365) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 899 Score = 31.6 bits (70), Expect = 2.0 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -2 Query: 252 NSWPLSAQSIARLKSLPVTGTLLLG-LESSNCPW*KSSNGLRPSFLNK*NSGVQTALKSL 76 N WPL + + L+ L VT L LG LE SN PW P F+ K SG L+ L Sbjct: 29 NQWPLKQEKLQALQQL-VTEQLQLGHLEESNSPW------NTPVFVIKKKSGKWRLLQDL 81
>POL_MMTVC (P11283) Pol polyprotein [Contains: Reverse transcriptase (EC| 2.7.7.49); Endonuclease] (Fragment) Length = 114 Score = 31.6 bits (70), Expect = 2.0 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -2 Query: 252 NSWPLSAQSIARLKSLPVTGTLLLG-LESSNCPW*KSSNGLRPSFLNK*NSGVQTALKSL 76 N WPL + + L+ L VT L LG LE SN PW P F+ K SG L+ L Sbjct: 29 NQWPLKQEKLQALQQL-VTEQLQLGHLEESNSPW------NTPVFVIKKKSGKWRLLQDL 81
>AXP1_YARLI (Q92389) Acid extracellular protease precursor (EC 3.4.23.-)| Length = 397 Score = 29.6 bits (65), Expect = 7.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 60 SLKKLPRILEQSAHQSFTCSKKMGEGHLNFFTTGSLMIQDRVTMCQLQEE 209 SLK +PR+ Q +Q F+ S G ++ F +++ TM L+ + Sbjct: 226 SLKTIPRVATQGGYQHFSVSASGKFGDVDLFDNDLVILDSGTTMTYLKSD 275
>CXE1_MOUSE (Q921C1) Gap junction epsilon-1 protein (Connexin-29) (Cx29)| Length = 258 Score = 29.3 bits (64), Expect = 9.9 Identities = 17/59 (28%), Positives = 23/59 (38%) Frame = -2 Query: 372 SITCFNSREKNKIICLSSTEQTLHLCHLMLHPTLGFWSNGNSWPLSAQSIARLKSLPVT 196 S TCF S K I L+ C L + L G W + ++ LK LP + Sbjct: 178 STTCFQSHPSEKTIFLNIMFGISGACFLFIFLELALLGLGRFWRIYKHKLSFLKKLPTS 236
>Y110_PASMU (Q9CPD7) Hypothetical protein PM0110| Length = 256 Score = 29.3 bits (64), Expect = 9.9 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 21 QNCLNTLFLICMMSLKKLPRILEQSAHQS 107 QN N F + +S KKL +ILE S HQS Sbjct: 158 QNSFNREFTLYCISWKKLYQILESSIHQS 186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,529,260 Number of Sequences: 219361 Number of extensions: 1738307 Number of successful extensions: 4532 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4532 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)