| Clone Name | baal17f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPR3A_HUMAN (Q16821) Protein phosphatase 1 regulatory subunit 3A... | 33 | 0.72 | 2 | GDE1_YEAST (Q02979) Glycerophosphodiester phosphodiesterase GDE1... | 30 | 6.1 |
|---|
>PPR3A_HUMAN (Q16821) Protein phosphatase 1 regulatory subunit 3A (Protein| phosphatase 1 glycogen-associated regulatory subunit) (Protein phosphatase type-1 glycogen targeting subunit) Length = 1122 Score = 33.1 bits (74), Expect = 0.72 Identities = 20/72 (27%), Positives = 39/72 (54%) Frame = -2 Query: 346 IFIGISEYRLSNVATVLWTQVFPFRLSFVKLLTFVIGAAAKLLETFLPESSFIPTT*LPK 167 I++G++E + N T+L Q ++ K+ IGA+ + L T L E + IPT + Sbjct: 522 IYLGVNEKQRKNFQTILHDQ--ERKMGNPKISVAGIGASNRDLATLLSEHTAIPTRAITA 579 Query: 166 SLANTMGSNVLW 131 ++++ +N+ W Sbjct: 580 DVSHSPRTNLSW 591
>GDE1_YEAST (Q02979) Glycerophosphodiester phosphodiesterase GDE1 (EC 3.1.4.46)| Length = 1223 Score = 30.0 bits (66), Expect = 6.1 Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 192 NEDSGKKVSSNFAAAPITKVRSLTKESLKGNTCVH---KTVATLESLYSEMPMNIG 350 N+ +GK +++++ + ++ K + KGN H + TL+ L+ ++P N+G Sbjct: 1001 NDPNGKSNNAHWSDNRMRLTKTFKKNNFKGNARGHSIASSFVTLKELFKKIPANVG 1056 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,190,388 Number of Sequences: 219361 Number of extensions: 1851144 Number of successful extensions: 4336 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4335 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)