| Clone Name | baal17e21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BEH3_ARATH (O49404) BES1/BZR1 homolog protein 3 | 37 | 0.036 | 2 | BEH4_ARATH (Q9ZV88) BES1/BZR1 homolog protein 4 | 33 | 0.40 | 3 | ROBO2_MOUSE (Q7TPD3) Roundabout homolog 2 precursor | 29 | 7.5 | 4 | SLAF6_MOUSE (Q9ET39) SLAM family member 6 precursor (Lymphocyte ... | 29 | 9.7 |
|---|
>BEH3_ARATH (O49404) BES1/BZR1 homolog protein 3| Length = 284 Score = 37.0 bits (84), Expect = 0.036 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +1 Query: 4 IHEECASDELELTLGSSRTR 63 IH EC SD+LELTLG+SRTR Sbjct: 265 IHGECVSDDLELTLGNSRTR 284
>BEH4_ARATH (Q9ZV88) BES1/BZR1 homolog protein 4| Length = 325 Score = 33.5 bits (75), Expect = 0.40 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +1 Query: 4 IHEECASDELELTLGSSRTR 63 IHEE SD+LELTLG+S TR Sbjct: 306 IHEESGSDDLELTLGNSSTR 325
>ROBO2_MOUSE (Q7TPD3) Roundabout homolog 2 precursor| Length = 1470 Score = 29.3 bits (64), Expect = 7.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 230 AEDRRNDPSTPFSLSTNTELAEHQNDAPMQVSKGRPRR 117 + +R P++PFS +NT A++Q+ P K + R Sbjct: 1261 SSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGR 1298
>SLAF6_MOUSE (Q9ET39) SLAM family member 6 precursor (Lymphocyte antigen 108)| Length = 351 Score = 28.9 bits (63), Expect = 9.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 92 AATSVCLFFAWVFPLILALGRRSDVLQA 175 A S C W+FPL+ LG S+V Q+ Sbjct: 8 APDSACQRMVWLFPLVFCLGSGSEVSQS 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,913,134 Number of Sequences: 219361 Number of extensions: 1612750 Number of successful extensions: 4472 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4467 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)