| Clone Name | baal16n13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CSN12_KLULA (Q6CPB1) COP9 signalosome complex subunit 12 | 30 | 1.1 | 2 | STO_ARATH (Q96288) Salt-tolerance protein | 29 | 2.4 | 3 | GLTB_ECOLI (P09831) Glutamate synthase [NADPH] large chain precu... | 28 | 4.1 | 4 | MSTAB_DROME (P83501) Protein msta, isoform B | 28 | 7.0 | 5 | PPNK_HELPY (O25944) Probable inorganic polyphosphate/ATP-NAD kin... | 28 | 7.0 | 6 | NU5M_YARLI (Q9B6D3) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 27 | 9.1 |
|---|
>CSN12_KLULA (Q6CPB1) COP9 signalosome complex subunit 12| Length = 424 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = -3 Query: 320 RFALQLHMFHG----NQAIGTKGLQNPFAYIHTYISLVYSYFIRSKIFVVLL 177 RF + +++G N A+G K LQ F Y S+ +Y +RS++ + L+ Sbjct: 212 RFKFYMGLYYGYEKNNYALGFKWLQETFDICTLYESIPSTYKVRSQVLIYLI 263
>STO_ARATH (Q96288) Salt-tolerance protein| Length = 248 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +1 Query: 16 DDDDEDYLIVPDLG 57 DDDDE++ IVPDLG Sbjct: 235 DDDDEEHFIVPDLG 248
>GLTB_ECOLI (P09831) Glutamate synthase [NADPH] large chain precursor (EC| 1.4.1.13) (Glutamate synthase alpha subunit) (NADPH-GOGAT) (GLTS alpha chain) Length = 1517 Score = 28.5 bits (62), Expect = 4.1 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -3 Query: 293 HGNQAIGTKGLQNPFAYIHTYISLVYSYF 207 +G +A+G+ G PFA + + ++Y YF Sbjct: 509 NGQEAVGSMGDDTPFAVLSSQPRIIYDYF 537
>MSTAB_DROME (P83501) Protein msta, isoform B| Length = 448 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 6/44 (13%) Frame = +2 Query: 182 ARQIFWNG*SMSKLVICMCVCMQRDS------AILLCRSLGCRG 295 AR+IF M+K IC CV Q + + L CR GCRG Sbjct: 281 ARKIFLG---MTKHFICKCVRCQDPTENGTYLSALFCREQGCRG 321
>PPNK_HELPY (O25944) Probable inorganic polyphosphate/ATP-NAD kinase (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase) Length = 284 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 249 KGILQSFCADRLVAVEHMKLQGESGKYFHKRDGFISVIYFVLXXKK 386 K LQ F DR+ EH+ L+G GK F ++ V+ KK Sbjct: 107 KDFLQDFKQDRIKLEEHLALEGRIGK-----TSFYAINEIVIAKKK 147
>NU5M_YARLI (Q9B6D3) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 655 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = -3 Query: 359 YTDKPISFVKVFPRFA----LQLHMFHGNQAIGTKGLQNPFAYIHTYISLVYSYFIRSKI 192 Y P+ + +F FA +++ G +GT L N F+Y T S+ Y + I Sbjct: 457 YITLPMFILAIFAMFAGWILKDIYLGVGTDFVGTHILPNNFSYFDTEFSITQFYKLLPLI 516 Query: 191 FVVLL 177 +L+ Sbjct: 517 SAILV 521 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,420,109 Number of Sequences: 219361 Number of extensions: 885818 Number of successful extensions: 2191 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2191 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)