| Clone Name | baal17b17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUCR1_MOUSE (Q99MT6) Succinate receptor 1 (G-protein coupled rec... | 30 | 1.3 | 2 | TRPD_BACPU (P18261) Anthranilate phosphoribosyltransferase (EC 2... | 28 | 4.9 | 3 | COX3_THEPA (Q36098) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) ... | 28 | 8.3 |
|---|
>SUCR1_MOUSE (Q99MT6) Succinate receptor 1 (G-protein coupled receptor 91)| Length = 317 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = -1 Query: 225 FYATVKYAIQYVFCIYISFAVKYATQYMFCSHNFLQANLYKF 100 +Y + YAI+++F + + V + Y+FC N+ +N+Y F Sbjct: 20 YYLSAFYAIEFIFGLLGNVTVVFG--YLFCMKNWNSSNVYLF 59
>TRPD_BACPU (P18261) Anthranilate phosphoribosyltransferase (EC 2.4.2.18)| Length = 340 Score = 28.5 bits (62), Expect = 4.9 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 4/72 (5%) Frame = +3 Query: 18 DDPSKYSMCGVVCIVYVAACAFIMKS**ICTDWLXGSCDYRTCIGLHI--SPQ--RKYIY 185 D S +++ IV AA A I K GS D C+G+HI +P+ R+ I Sbjct: 82 DGLSTFNISTAAAIVRSAAGAKIAKHGNRSVSSKSGSADVLECLGIHIQSTPEETRRQIQ 141 Query: 186 RRRIGLRTSPLH 221 + +G +PL+ Sbjct: 142 EKNMGFLFAPLY 153
>COX3_THEPA (Q36098) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) Length = 255 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -1 Query: 231 FFFYATVKYAIQYVFCIYISFAVKYATQYMFCSHNFLQANLYKFIMIS 88 + FY+T ++Y+ Y +F + Y QY+ ++ +F M S Sbjct: 22 YLFYSTGLDTLEYIDSTYKNFIIMYVNQYLLYGTTLKYLSVGEFFMNS 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,304,415 Number of Sequences: 219361 Number of extensions: 581487 Number of successful extensions: 1267 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)