| Clone Name | baal16f22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CUBN_CANFA (Q9TU53) Cubilin precursor | 32 | 0.59 | 2 | CUBN_RAT (O70244) Cubilin precursor (Intrinsic factor-cobalamin ... | 30 | 1.3 | 3 | YGZC_YEAST (P53058) Hypothetical 22.2 kDa protein in ADH4 5'region | 30 | 2.2 | 4 | TS1R1_HUMAN (Q7RTX1) Taste receptor type 1 member 1 precursor (G... | 28 | 6.5 | 5 | CUBN_HUMAN (O60494) Cubilin precursor (Intrinsic factor-cobalami... | 28 | 8.5 | 6 | Y3824_CHRVO (P60012) UPF0289 protein CV_3824 | 28 | 8.5 |
|---|
>CUBN_CANFA (Q9TU53) Cubilin precursor| Length = 3620 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 194 FHSSCGGF-HANSGSPVSKNFSYSIAPVLRASW 99 FH SCGG+ HA+ G S + + +P L SW Sbjct: 2085 FHKSCGGYLHADRGIITSPQYPETYSPNLNCSW 2117
>CUBN_RAT (O70244) Cubilin precursor (Intrinsic factor-cobalamin receptor)| (Intrinsic factor-vitamin B12 receptor) (Glycoprotein 280) (gp280) (460 kDa receptor) Length = 3623 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 194 FHSSCGGF-HANSGSPVSKNFSYSIAPVLRASW 99 FH SCGG+ HA+ G S + + P L SW Sbjct: 2088 FHKSCGGYLHADRGVITSPKYPDTYLPNLNCSW 2120
>YGZC_YEAST (P53058) Hypothetical 22.2 kDa protein in ADH4 5'region| Length = 206 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = +1 Query: 52 PLVIVIGDHTCDPSALQDAL------RTGAIEYEKFLETGD 156 PL+ +TC+P ++ DA+ TG IEY + +T D Sbjct: 98 PLIFTTNINTCNPQSIGDAMVPFANTVTGEIEYNSWADTAD 138
>TS1R1_HUMAN (Q7RTX1) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) (Gm148) Length = 841 Score = 28.1 bits (61), Expect = 6.5 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 8/55 (14%) Frame = -1 Query: 176 GFH--------ANSGSPVSKNFSYSIAPVLRASWRAEGSQV*SPITITSGFLKEH 36 GFH +G+ ++K+ Y P + W EGSQ P T+ L+EH Sbjct: 511 GFHHCCFECVPCGAGTFLNKSDLYRCQPCGKEEWAPEGSQTCFPRTVVFLALREH 565
>CUBN_HUMAN (O60494) Cubilin precursor (Intrinsic factor-cobalamin receptor)| (Intrinsic factor-vitamin B12 receptor) (460 kDa receptor) (Intestinal intrinsic factor receptor) Length = 3623 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -1 Query: 194 FHSSCGGF-HANSGSPVSKNFSYSIAPVLRASW 99 FH SCGG+ HA+ G S + + L SW Sbjct: 2088 FHKSCGGYLHADRGIITSPKYPETYPSNLNCSW 2120
>Y3824_CHRVO (P60012) UPF0289 protein CV_3824| Length = 252 Score = 27.7 bits (60), Expect = 8.5 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = -2 Query: 151 QFPRTSHIRLPLFSEHLGGL------KDHRYDHQ*LLQVAF 47 +FP T R+ L E+L G KDH +DH LQV F Sbjct: 5 EFPVTERTRILLRLEYLYGRLAYFIGKDHPHDHHAALQVLF 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,825,546 Number of Sequences: 219361 Number of extensions: 553068 Number of successful extensions: 1454 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1453 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)