ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal15o24 |
|---|---|
| Clone Library Name | barley_pub |
>ALEU_HORVU (P05167) Thiol protease aleurain precursor (EC 3.4.22.16)| Length = 362 Score = 63.5 bits (153), Expect = 1e-10 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCASYP 80 DWGDNGYFKMEMGKNMCAIATCASYP Sbjct: 333 DWGDNGYFKMEMGKNMCAIATCASYP 358
>ORYC_ORYSA (P25778) Oryzain gamma chain precursor (EC 3.4.22.-)| Length = 362 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCASYP 80 DWGDNGYF MEMGKNMC IATCASYP Sbjct: 334 DWGDNGYFTMEMGKNMCGIATCASYP 359
>ALEU_ARATH (Q8H166) Thiol protease aleurain precursor (EC 3.4.22.16) (AtALEU)| (Senescence-associated gene product 2) Length = 358 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCASYP 80 DWGD GYFKMEMGKNMC IATCASYP Sbjct: 330 DWGDKGYFKMEMGKNMCGIATCASYP 355
>CYSP2_MAIZE (Q10717) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 360 Score = 59.3 bits (142), Expect = 2e-09 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCASYP 80 DWGD GYFKMEMGKNMC +ATCASYP Sbjct: 332 DWGDEGYFKMEMGKNMCGVATCASYP 357
>ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC 3.4.22.16)| Length = 358 Score = 58.9 bits (141), Expect = 3e-09 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCASYP 80 +WGDNGYFKMEMGKNMC +ATC+SYP Sbjct: 330 EWGDNGYFKMEMGKNMCGVATCSSYP 355
>CYSP3_LYCES (Q40143) Cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 356 Score = 58.2 bits (139), Expect = 5e-09 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCASYP 80 DWG++GYFKMEMGKNMC +ATCASYP Sbjct: 328 DWGEDGYFKMEMGKNMCGVATCASYP 353
>CATH_RAT (P00786) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3)| (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 48.9 bits (115), Expect = 3e-06 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCASYP 80 +WG+NGYF +E GKNMC +A CASYP Sbjct: 304 NWGNNGYFLIERGKNMCGLAACASYP 329
>CATH_MOUSE (P49935) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3)| (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 48.9 bits (115), Expect = 3e-06 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCASYP 80 WG+NGYF +E GKNMC +A CASYP Sbjct: 305 WGENGYFLIERGKNMCGLAACASYP 329
>CATH_PIG (O46427) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 47.0 bits (110), Expect = 1e-05 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCASYP 80 WG NGYF +E GKNMC +A CASYP Sbjct: 307 WGMNGYFLIERGKNMCGLAACASYP 331
>CATH_HUMAN (P09668) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 47.0 bits (110), Expect = 1e-05 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCASYP 80 WG NGYF +E GKNMC +A CASYP Sbjct: 307 WGMNGYFLIERGKNMCGLAACASYP 331
>CATL2_HUMAN (O60911) Cathepsin L2 precursor (EC 3.4.22.43) (Cathepsin V)| (Cathepsin U) Length = 334 Score = 35.8 bits (81), Expect = 0.026 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG NGY K+ K N C IAT ASYP Sbjct: 306 EWGSNGYVKIAKDKNNHCGIATAASYP 332
>CYSP2_HOMAM (P25782) Digestive cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 323 Score = 35.4 bits (80), Expect = 0.033 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGK-NMCAIATCASYP 80 WGD GY KM + N C IAT ASYP Sbjct: 296 WGDAGYIKMSRNRNNNCGIATVASYP 321
>CATL_CHICK (P09648) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] (Fragments) Length = 218 Score = 34.3 bits (77), Expect = 0.074 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMG-KNMCAIATCASYP 80 WGD GY M KN C IAT ASYP Sbjct: 191 WGDKGYIYMAKDRKNHCGIATAASYP 216
>CATL_CANFA (Q9GL24) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 333 Score = 34.3 bits (77), Expect = 0.074 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNM-CAIATCASYP 80 +WG NGY KM +N C IAT ASYP Sbjct: 305 EWGWNGYVKMAKDQNNHCGIATAASYP 331
>CATL_BOVIN (P25975) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 34.3 bits (77), Expect = 0.074 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNM-CAIATCASYP 80 +WG NGY KM +N C IAT ASYP Sbjct: 306 EWGWNGYVKMAKDQNNHCGIATAASYP 332
>CATL_SHEEP (Q10991) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] Length = 217 Score = 33.9 bits (76), Expect = 0.097 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNM-CAIATCASYP 80 +WG+ GY KM +N C IAT ASYP Sbjct: 189 EWGNKGYVKMAKDQNNHCGIATAASYP 215
>CATL_SARPE (Q26636) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 339 Score = 33.9 bits (76), Expect = 0.097 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGKN-MCAIATCASYP 80 WG+ GY KM +N C IAT +SYP Sbjct: 312 WGEQGYIKMARNQNNQCGIATASSYP 337
>CATB_RAT (P00787) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (RSG-2)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 33.9 bits (76), Expect = 0.097 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWGDNG+FK+ G+N C I Sbjct: 303 DWGDNGFFKILRGENHCGI 321
>CATB_MOUSE (P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 33.9 bits (76), Expect = 0.097 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWGDNG+FK+ G+N C I Sbjct: 303 DWGDNGFFKILRGENHCGI 321
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +3 Query: 3 DWGDNGYFKMEMG----KNMCAIATCASYP 80 DWG+NGY +ME C IA ASYP Sbjct: 344 DWGENGYIRMERNVTARTGKCGIAMMASYP 373
>CATL_DROME (Q95029) Cathepsin L precursor (EC 3.4.22.15) (Cysteine proteinase| 1) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 341 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGK-NMCAIATCASYP 80 WGD G+ KM K N C IA+ +SYP Sbjct: 314 WGDKGFIKMLRNKENQCGIASASSYP 339
>CATL_SCHMA (Q26534) Cathepsin L precursor (EC 3.4.22.15) (SMCL1)| Length = 319 Score = 33.1 bits (74), Expect = 0.17 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCAS 74 +WG+NGYF+M G C I T A+ Sbjct: 291 EWGENGYFRMYRGDGSCGINTVAT 314
>CATL_PIG (Q28944) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 33.1 bits (74), Expect = 0.17 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG NGY KM + N C I+T ASYP Sbjct: 306 EWGWNGYVKMAKDQNNHCGISTAASYP 332
>CYSEP_RICCO (O65039) Vignain precursor (EC 3.4.22.-) (Cysteine endopeptidase)| Length = 360 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 4/30 (13%) Frame = +3 Query: 3 DWGDNGYFKMEMG----KNMCAIATCASYP 80 +WG+ GY +ME G + +C IA ASYP Sbjct: 312 EWGEKGYIRMERGISDKEGLCGIAMEASYP 341
>PAPA5_CARPA (P05993) Cysteine proteinase (EC 3.4.22.-) (Clone PLBPC13)| (Fragment) Length = 96 Score = 32.3 bits (72), Expect = 0.28 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCAS 74 +WG+NGY+K+ G+N+C + + S Sbjct: 63 NWGENGYYKICRGRNICGVDSMVS 86
>CRUST_PANBO (Q86GF7) Crustapain precursor (EC 3.4.22.-) (NsCys)| Length = 323 Score = 32.3 bits (72), Expect = 0.28 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGK-NMCAIATCASYP 80 WG++GY KM + N CAIAT + YP Sbjct: 296 WGESGYIKMARNRDNNCAIATYSVYP 321
>CYSP_SCHMA (P25792) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sm31) Length = 340 Score = 32.0 bits (71), Expect = 0.37 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+NGYF++ G++ C+I Sbjct: 312 DWGENGYFRIVRGRDECSI 330
>CATB_BOVIN (P07688) Cathepsin B precursor (EC 3.4.22.1) [Contains: Cathepsin B| light chain; Cathepsin B heavy chain] Length = 335 Score = 32.0 bits (71), Expect = 0.37 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWGDNG+FK+ G++ C I Sbjct: 303 DWGDNGFFKILRGQDHCGI 321
>CYSP1_HOMAM (P13277) Digestive cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 322 Score = 32.0 bits (71), Expect = 0.37 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGK-NMCAIATCASYP 80 WG++GY KM + N C IAT A YP Sbjct: 295 WGESGYIKMARNRNNNCGIATDACYP 320
>CATB_HUMAN (P07858) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (APP| secretase) (APPS) [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 32.0 bits (71), Expect = 0.37 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWGDNG+FK+ G++ C I Sbjct: 303 DWGDNGFFKILRGQDHCGI 321
>CATL_BRUPA (O17473) Cathepsin L-like precursor (EC 3.4.22.15)| Length = 395 Score = 32.0 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 DWG +GY M + NMC IA+ AS+P Sbjct: 368 DWGKDGYVYMARNRGNMCHIASAASFP 394
>CATB1_GIALA (P92131) Cathepsin B-like CP1 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B1) Length = 303 Score = 31.6 bits (70), Expect = 0.48 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+NGYF++ G N C I Sbjct: 275 DWGENGYFRIVRGVNECRI 293
>ACP2_ENTHI (P36185) Cysteine proteinase ACP2 precursor (EC 3.4.22.-)| (Fragment) Length = 310 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCASYP 80 WGD GY M + N C +AT YP Sbjct: 280 WGDKGYINMVIEGNTCGVATDPLYP 304
>CYSP1_OSTOS (P25802) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 341 Score = 31.6 bits (70), Expect = 0.48 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMC 53 DWG+NG+F+M G N C Sbjct: 313 DWGENGFFRMHRGSNDC 329
>CPP3_ENTHI (Q06964) Cysteine proteinase 3 precursor (EC 3.4.22.-) (Cysteine| proteinase ACP3) (Fragment) Length = 308 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCASYP 80 WGD GY M + N C +AT YP Sbjct: 278 WGDKGYINMVIEGNTCGVATDPLYP 302
>CATC_HUMAN (P53634) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 31.6 bits (70), Expect = 0.48 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCA 71 WG+NGYF++ G + CAI + A Sbjct: 433 WGENGYFRIRRGTDECAIESIA 454
>CPP2_ENTHI (Q01958) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 315 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCASYP 80 WGD GY M + N C +AT YP Sbjct: 285 WGDKGYINMVIEGNTCGVATDPLYP 309
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 31.2 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 4/29 (13%) Frame = +3 Query: 6 WGDNGYFKMEMGKNM----CAIATCASYP 80 WG++GY +ME N+ C IA ASYP Sbjct: 327 WGESGYVRMERNINVTTGKCGIAMMASYP 355
>CYSP_HEMSP (P43156) Thiol protease SEN102 precursor (EC 3.4.22.-)| Length = 360 Score = 31.2 bits (69), Expect = 0.63 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 4/30 (13%) Frame = +3 Query: 3 DWGDNGYFKMEMG----KNMCAIATCASYP 80 +WG++GY +M+ G + C IA ASYP Sbjct: 315 EWGESGYIRMQRGISDKRGKCGIAMEASYP 344
>CATL_RAT (P07154) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (Cyclic protein 2) (CP-2) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 31.2 bits (69), Expect = 0.63 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNM-CAIATCASYP 80 +WG +GY K+ +N C +AT ASYP Sbjct: 305 EWGMDGYIKIAKDRNNHCGLATAASYP 331
>CATL_HUMAN (P07711) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 333 Score = 31.2 bits (69), Expect = 0.63 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG GY KM + N C IA+ ASYP Sbjct: 305 EWGMGGYVKMAKDRRNHCGIASAASYP 331
>CYSP1_DICDI (P04988) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 343 Score = 30.8 bits (68), Expect = 0.82 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCAS 74 DWG+ GY + GKN C ++ S Sbjct: 316 DWGEQGYIYLRRGKNTCGVSNFVS 339
>CATB2_GIALA (P92132) Cathepsin B-like CP2 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B2) Length = 300 Score = 30.8 bits (68), Expect = 0.82 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG++GYF+M G N C+I Sbjct: 271 DWGEDGYFRMIRGINDCSI 289
>CYSP3_HOMAM (P25784) Digestive cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 321 Score = 30.8 bits (68), Expect = 0.82 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGK-NMCAIATCASYP 80 WGD GY KM + N C IA+ SYP Sbjct: 294 WGDAGYIKMSRNRDNNCGIASEPSYP 319
>CATL_MOUSE (P06797) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (p39 cysteine proteinase) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 30.8 bits (68), Expect = 0.82 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG GY K+ + N C +AT ASYP Sbjct: 305 EWGMEGYIKIAKDRDNHCGLATAASYP 331
>RD19A_ARATH (P43296) Cysteine proteinase RD19a precursor (EC 3.4.22.-) (RD19)| Length = 368 Score = 30.4 bits (67), Expect = 1.1 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCAS 74 WG+NG++K+ G+N+C + + S Sbjct: 335 WGENGFYKICKGRNICGVDSMVS 357
>CYSEP_VIGMU (P12412) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase) (Sulfhydryl-endopeptidase) (SH-EP) [Contains: Vignain-1; Vignain-2] Length = 362 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = +3 Query: 3 DWGDNGYFKMEMG----KNMCAIATCASYP 80 +WG+ GY +M+ + +C IA ASYP Sbjct: 314 EWGEQGYIRMQRNISKKEGLCGIAMMASYP 343
>CATF_HUMAN (Q9UBX1) Cathepsin F precursor (EC 3.4.22.41) (CATSF)| Length = 484 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCAS 74 DWG+ GY+ + G C + T AS Sbjct: 456 DWGEKGYYYLHRGSGACGVNTMAS 479
>A494_ARATH (P43295) Probable cysteine proteinase A494 precursor (EC 3.4.22.-)| Length = 361 Score = 30.4 bits (67), Expect = 1.1 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCAS 74 WG+NG++K+ G+N+C + + S Sbjct: 332 WGENGFYKICKGRNICGVDSLVS 354
>CYSP2_HAECO (P25793) Cathepsin B-like cysteine proteinase 2 precursor (EC| 3.4.22.-) Length = 342 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ GYF++ G N C I Sbjct: 310 DWGEKGYFRIVRGSNDCGI 328
>CYSP_PEA (P25804) Cysteine proteinase 15A precursor (EC 3.4.22.-)| (Turgor-responsive protein 15A) Length = 363 Score = 30.0 bits (66), Expect = 1.4 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCAS 74 +WG+ GY+K+ G+N+C + + S Sbjct: 331 NWGEQGYYKICRGRNVCGVDSMVS 354
>CPR4_CAEEL (P43508) Cathepsin B-like cysteine proteinase 4 precursor (EC| 3.4.22.-) (Cysteine protease-related 4) Length = 335 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 +WG+NGYF++ G N C I Sbjct: 306 NWGENGYFRIIRGTNECGI 324
>CATC_MOUSE (P97821) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 462 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCA 71 +WG++GYF++ G + CAI + A Sbjct: 431 NWGESGYFRIRRGTDECAIESIA 453
>CATV_NPVLD (Q9YMP9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 356 Score = 30.0 bits (66), Expect = 1.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+NGYF++ N C + Sbjct: 327 DWGENGYFRVRQNVNACGM 345
>CPP1_ENTHI (Q01957) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 315 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCASYP 80 WG+ GY M + N C +AT YP Sbjct: 285 WGEKGYINMVIEGNTCGVATDPLYP 309
>CATV_NPVOP (O10364) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 29.6 bits (65), Expect = 1.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG++GYF+++ N C I Sbjct: 295 DWGEDGYFRVQQNINACGI 313
>CATW_HUMAN (P56202) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 376 Score = 29.6 bits (65), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAI 59 WG+ GYF++ G N C I Sbjct: 337 WGEKGYFRLHRGSNTCGI 354
>CATF_MOUSE (Q9R013) Cathepsin F precursor (EC 3.4.22.41)| Length = 462 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIATCAS 74 DWG+ GY+ + G C + T AS Sbjct: 434 DWGEEGYYYLYRGSGACGVNTMAS 457
>CATC_RAT (P80067) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion domai Length = 462 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCA 71 WG++GYF++ G + CAI + A Sbjct: 432 WGESGYFRIRRGTDECAIESIA 453
>CATC_CANFA (O97578) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 435 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCA 71 WG++GYF++ G + CAI + A Sbjct: 405 WGEDGYFRIRRGTDECAIESIA 426
>CATK_PIG (Q9GLE3) Cathepsin K precursor (EC 3.4.22.38)| Length = 330 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG+ GY M K N C IA AS+P Sbjct: 302 NWGNKGYILMARNKNNACGIANLASFP 328
>CATC_MACFA (Q60HG6) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCA 71 WG++GYF++ G + CAI + A Sbjct: 433 WGEDGYFRIRRGTDECAIESIA 454
>CATK_MACMU (P61277) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG+ GY M K N C IA AS+P Sbjct: 301 NWGNKGYILMARNKNNACGIANLASFP 327
>CATK_MACFA (P61276) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG+ GY M K N C IA AS+P Sbjct: 301 NWGNKGYILMARNKNNACGIANLASFP 327
>CATK_HUMAN (P43235) Cathepsin K precursor (EC 3.4.22.38) (Cathepsin O)| (Cathepsin X) (Cathepsin O2) Length = 329 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG+ GY M K N C IA AS+P Sbjct: 301 NWGNKGYILMARNKNNACGIANLASFP 327
>CATJ_MOUSE (Q9R014) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMG-KNMCAIATCASYP 80 +WG NGY ++ N C IA+ ASYP Sbjct: 305 EWGMNGYMQIAKDHNNHCGIASLASYP 331
>CYSP1_HAECO (P19092) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 342 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ GYF++ G N C I Sbjct: 310 DWGEKGYFRIIRGTNDCGI 328
>CATV_NPVHC (Q9WGE0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ GYF+++ N C I Sbjct: 295 DWGEQGYFRVQQNINACGI 313
>CATV_NPVCF (P41715) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ GYF+++ N C I Sbjct: 295 DWGEQGYFRVQQNINACGI 313
>CATV_NPVCD (O41479) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ GYF+++ N C I Sbjct: 295 DWGEQGYFRVQQNINACGI 313
>CATV_NPVAP (Q91CL9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ GYF+++ N C I Sbjct: 295 DWGEQGYFRVQQNINACGI 313
>CATK_RABIT (P43236) Cathepsin K precursor (EC 3.4.22.38) (OC-2 protein)| Length = 329 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGK-NMCAIATCASYP 80 WG+ GY M K N C IA AS+P Sbjct: 302 WGNKGYILMARNKNNACGIANLASFP 327
>CATO_HUMAN (P43234) Cathepsin O precursor (EC 3.4.22.42)| Length = 321 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCAS 74 WG +GY ++MG N+C IA S Sbjct: 295 WGVDGYAHVKMGSNVCGIADSVS 317
>CATV_NPVEP (Q91GE3) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ G+FK++ N C I Sbjct: 294 DWGEQGFFKIQQNVNACGI 312
>CATS_MOUSE (O70370) Cathepsin S precursor (EC 3.4.22.27)| Length = 340 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMG-KNMCAIATCASYP 80 ++GD GY +M KN C IA+ SYP Sbjct: 312 NFGDQGYIRMARNNKNHCGIASYCSYP 338
>LMCPB_LEIME (P36400) Cysteine proteinase B precursor (EC 3.4.22.-)| Length = 443 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIA 62 DWG+ GY ++ MG N C ++ Sbjct: 313 DWGEQGYVRVVMGVNACLLS 332
>CYSP7_DICDI (Q94504) Cysteine proteinase 7 precursor (EC 3.4.22.-) (Proteinase| 1) Length = 460 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMG-KNMCAIATCASYP 80 WG +GY M G N C IAT AS P Sbjct: 429 WGMDGYILMTKGNNNQCGIATMASRP 454
>CYSP2_LEIPI (Q05094) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-2) Length = 444 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAIA 62 DWG+ GY ++ MG N C ++ Sbjct: 314 DWGEQGYVRVVMGVNACLLS 333
>CYSEP_PHAVU (P25803) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase EP-C1) Length = 362 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = +3 Query: 3 DWGDNGYFKMEMG----KNMCAIATCASYP 80 +WG++GY +M+ + +C IA SYP Sbjct: 314 EWGEHGYIRMQRNISKKEGLCGIAMLPSYP 343
>CATV_GVCP (O91466) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 333 Score = 28.9 bits (63), Expect = 3.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 +WG+ GYF+++ KN C + Sbjct: 305 EWGEEGYFRVQRDKNSCGM 323
>LMCPA_LEIME (P25775) Cysteine proteinase A precursor (EC 3.4.22.-)| Length = 354 Score = 28.5 bits (62), Expect = 4.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAI 59 WG+ GY ++ MG N C + Sbjct: 315 WGEKGYIRLAMGSNQCML 332
>CYSP1_LEIPI (P35591) Cysteine proteinase 1 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-1) Length = 354 Score = 28.5 bits (62), Expect = 4.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAI 59 WG+ GY ++ MG N C + Sbjct: 315 WGEKGYIRLAMGSNQCML 332
>CATS_RAT (Q02765) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMG-KNMCAIATCASYP 80 +GD GY +M KN C IA+ SYP Sbjct: 303 FGDQGYIRMARNNKNHCGIASYCSYP 328
>CATQ_RAT (Q9QZE3) Cathepsin Q precursor (EC 3.4.22.-)| Length = 343 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGKNM-CAIATCASYP 80 WG GY K+ +N CAIA+ A YP Sbjct: 316 WGLRGYMKIAKDRNNHCAIASLAQYP 341
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 4/29 (13%) Frame = +3 Query: 6 WGDNGYFKMEMG----KNMCAIATCASYP 80 WG++GY +ME C IA ASYP Sbjct: 286 WGEDGYIRMERNVASKSGKCGIAIEASYP 314
>ACP1_ENTHI (P36184) Cysteine proteinase ACP1 precursor (EC 3.4.22.-)| Length = 308 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEM-GKNMCAIATCASYP 80 WGD GYF + NMC I ++YP Sbjct: 277 WGDAGYFLLARDSNNMCGIGRDSNYP 302
>CATW_MOUSE (P56203) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 371 Score = 28.5 bits (62), Expect = 4.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAI 59 WG+ GYF++ G N C + Sbjct: 332 WGEKGYFRLYRGNNTCGV 349
>CYSP_SCHJA (P43157) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sj31) Length = 342 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ G F+M G++ C+I Sbjct: 313 DWGEKGLFRMVRGRDECSI 331
>GCP1_ARATH (Q94B08) Germination-specific cysteine protease 1 precursor (EC| 3.4.22.-) Length = 376 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +3 Query: 6 WGDNGYFKMEMG-----KNMCAIATCASYP 80 WG+ GY +ME C IA ASYP Sbjct: 331 WGEEGYIRMERNLAASKSGKCGIAVEASYP 360
>CYSP_TRYBB (P14658) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 450 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCAS 74 WG++GY ++E G N C + S Sbjct: 313 WGEDGYIRIEKGTNQCLMNQAVS 335
>CYSP2_DICDI (P04989) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Prestalk| cathepsin) Length = 376 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMG-KNMCAIATCASYP 80 WG GY M KN C IA+ +SYP Sbjct: 349 WGIKGYILMSKDRKNNCGIASVSSYP 374
>CPR1_DROME (Q9VN93) Putative cysteine proteinase CG12163 precursor (EC| 3.4.22.-) Length = 614 Score = 28.1 bits (61), Expect = 5.3 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIATCAS 74 WG+ GY+++ G N C ++ A+ Sbjct: 587 WGEQGYYRVYRGDNTCGVSEMAT 609
>ATI2_HHV11 (P10230) Alpha trans-inducing factor 78 kDa protein| Length = 718 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 216 VCIHSKVSVPVYPNLQVLVRAENTLFMSGESRLYSPIWRFFMPP 85 VC+++ + P P ++ AEN L+ G S L+SP R PP Sbjct: 636 VCVNTANAAPASPYIE----AENPLYDWGGSALFSPPGRTGPPP 675
>CYSP_THEPA (P22497) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 440 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 3/22 (13%) Frame = +3 Query: 3 DWGDNGYFKME---MGKNMCAI 59 DWG+NGY ++E MG + C + Sbjct: 409 DWGENGYMRLERTNMGTDKCGV 430
>CATV_NPVAH (Q80LP4) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 28.1 bits (61), Expect = 5.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG++GYF+++ N C + Sbjct: 308 DWGEDGYFRVKRNINACGL 326
>CYSP4_DICDI (P54639) Cysteine proteinase 4 precursor (EC 3.4.22.-)| Length = 442 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGKNM-CAIATCASYP 80 WG +GY M +N C IAT AS+P Sbjct: 412 WGMDGYIFMSKDRNNNCGIATMASFP 437
>CATR_MOUSE (Q9JIA9) Cathepsin R precursor (EC 3.4.22.-)| Length = 334 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 6 WGDNGYFKMEMGK-NMCAIATCASYP 80 WG GY K+ K N C IA+ A YP Sbjct: 307 WGIRGYMKLAKDKNNHCGIASYAHYP 332
>CATJ_RAT (Q63088) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 3 DWGDNGYFKMEMGK-NMCAIATCASYP 80 +WG NG+ K+ + N C IA+ AS+P Sbjct: 305 EWGINGFMKIAKDRNNHCGIASQASFP 331
>CATW_FELCA (Q9TST1) Cathepsin W precursor (EC 3.4.22.-)| Length = 374 Score = 27.7 bits (60), Expect = 7.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAI 59 WG GYF++ G N C I Sbjct: 335 WGXGGYFRLYRGNNTCGI 352
>CYSP3_OSTOS (Q06544) Cathepsin B-like cysteine proteinase 3 (EC 3.4.22.-)| (Fragment) Length = 174 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 3 DWGDNGYFKMEMGKNMCAI 59 DWG+ G+++M G N C I Sbjct: 147 DWGEKGFYRMIRGINNCRI 165
>ACTN_ACTCH (P00785) Actinidain precursor (EC 3.4.22.14) (Actinidin) (Allergen| Act c 1) Length = 380 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = +3 Query: 6 WGDNGYFKMEM---GKNMCAIATCASYP 80 WG+ GY ++ G C IAT SYP Sbjct: 314 WGEEGYMRILRNVGGAGTCGIATMPSYP 341
>CATO_MOUSE (Q8BM88) Cathepsin O precursor (EC 3.4.22.42)| Length = 312 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 6 WGDNGYFKMEMGKNMCAIA 62 WG GY ++MG N+C IA Sbjct: 286 WGVEGYAHVKMGGNVCGIA 304
>PROD_SCHPO (O74524) Probable proline oxidase, mitochondrial precursor (EC| 1.5.3.-) (Proline dehydrogenase) Length = 492 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = -2 Query: 191 FLYTPIFRFLF-----GLKTPYSCLANRDCTRRFGASSC 90 FLY P R+ F G +TP + +A D + G +SC Sbjct: 92 FLYNPFCRYTFYKHFCGGETPQAVMATMDTLQAAGITSC 130
>PRAM2_HUMAN (O60811) PRAME family member 2| Length = 474 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 253 TLPLYGCMAIYVGDPAIY*GFSCMS--TTFYF 342 TL L GC Y AI G SC S TTFYF Sbjct: 353 TLVLEGCQIHYSQLSAILPGLSCCSQLTTFYF 384
>CPR1_ARATH (Q9LT77) Probable cysteine proteinase At3g19400 precursor (EC| 3.4.22.-) Length = 362 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +3 Query: 3 DWGDNGYFKMEMGKN----MCAIATCASYP 80 +WGD+GY K++ + C IA SYP Sbjct: 318 NWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,473,286 Number of Sequences: 219361 Number of extensions: 1183605 Number of successful extensions: 2407 Number of sequences better than 10.0: 105 Number of HSP's better than 10.0 without gapping: 2355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2397 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
