| Clone Name | baal16d13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NPP_HORVU (Q687E1) Nucleotide pyrophosphatase/phosphodiesterase ... | 69 | 5e-12 | 2 | ZN513_HUMAN (Q8N8E2) Zinc finger protein 513 | 28 | 9.5 |
|---|
>NPP_HORVU (Q687E1) Nucleotide pyrophosphatase/phosphodiesterase (EC 3.-.-.-)| (Fragments) Length = 368 Score = 68.6 bits (166), Expect = 5e-12 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 13 NTGGFFDVKDSGGECGVPAETMYYYPXENR 102 NTGGFFDVKDSGGECGVPAETMYYYP ENR Sbjct: 131 NTGGFFDVKDSGGECGVPAETMYYYPAENR 160
>ZN513_HUMAN (Q8N8E2) Zinc finger protein 513| Length = 479 Score = 27.7 bits (60), Expect = 9.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 59 PHSPPESLTSKNPPVL 12 PHSPP L+S+ PP L Sbjct: 451 PHSPPSVLSSRGPPAL 466 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.140 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,639,333 Number of Sequences: 219361 Number of extensions: 112960 Number of successful extensions: 345 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 80,573,946 effective HSP length: 9 effective length of database: 78,599,697 effective search space used: 1886392728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)