| Clone Name | baal15g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAR1_KLULA (Q6CQE5) Protein TAR1 | 41 | 0.001 | 2 | TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to riboso... | 41 | 0.001 | 3 | VP4_ROTH1 (P11198) Outer capsid protein VP4 (Hemagglutinin) (Out... | 28 | 5.1 | 4 | CTGE5_MOUSE (Q8R311) Cutaneous T-cell lymphoma-associated antige... | 28 | 5.1 | 5 | SRY_HORSE (P36389) Sex-determining region Y protein (Testis-dete... | 28 | 8.7 |
|---|
>TAR1_KLULA (Q6CQE5) Protein TAR1| Length = 109 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -3 Query: 156 FTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 58 FT++FT FFS F H T SLSV+++YLAL G Sbjct: 12 FTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 44
>TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to ribosomal RNA| protein 1) Length = 124 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -3 Query: 156 FTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 58 FT++FT FFS F H T SLSV+++YLAL G Sbjct: 27 FTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 59
>VP4_ROTH1 (P11198) Outer capsid protein VP4 (Hemagglutinin) (Outer layer| protein VP4) [Contains: Outer capsid protein VP8; Outer capsid protein VP5] Length = 775 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 159 GFTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQGGTLLIHTGFHV 25 GF ++ + W F+ PH TT S T ++ IH F++ Sbjct: 165 GFLKFYNSVWTFYGETPHATTDYSSTSNLSEVE---TAIHVEFYI 206
>CTGE5_MOUSE (Q8R311) Cutaneous T-cell lymphoma-associated antigen 5 homolog| (cTAGE-5 protein) (Meningioma-expressed antigen 6) Length = 779 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 189 FPSHCLGAQRGFTFYFTTHWGFFSPFPH 106 FP + A RGF Y GFF P PH Sbjct: 724 FPGRTVYAPRGFPPYLPPRAGFFPPPPH 751
>SRY_HORSE (P36389) Sex-determining region Y protein (Testis-determining| factor) Length = 223 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 129 GFFSPFPHGTTSLSVTQEYLALQGGTLLIHTG 34 G PF G T++S Q+ L+ Q TL H+G Sbjct: 178 GAVKPFAAGATAISALQQELSQQHRTLRCHSG 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,158,083 Number of Sequences: 219361 Number of extensions: 550525 Number of successful extensions: 1198 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1198 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)