| Clone Name | baal15g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EFTU_CLOPE (Q8XFP8) Elongation factor Tu (EF-Tu) | 28 | 5.6 | 2 | F4RE_METTH (O26350) Putative F420-dependent NADP reductase (EC 1... | 28 | 5.6 | 3 | E41L2_HUMAN (O43491) Band 4.1-like protein 2 (Generally expresse... | 28 | 7.3 | 4 | OSTA_PHOLL (Q7N8V4) Organic solvent tolerance protein precursor | 27 | 9.5 |
|---|
>EFTU_CLOPE (Q8XFP8) Elongation factor Tu (EF-Tu)| Length = 397 Score = 28.1 bits (61), Expect = 5.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -1 Query: 344 SRARGPRVYSVEHFLASNRVIGVDDLSTFF----LMDGDHLMEL 225 S A GP + EH L S+RV GVD + F ++D + L+EL Sbjct: 107 SAADGPMPQTREHILLSSRV-GVDHIVVFLNKADMVDDEELLEL 149
>F4RE_METTH (O26350) Putative F420-dependent NADP reductase (EC 1.-.-.-)| Length = 232 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +3 Query: 108 VGSLEEEKAREASAPVLQVRQHDDSSME 191 +GS + EKA +A++ VL++ DD S+E Sbjct: 35 IGSRDAEKASKAASKVLEIAGRDDISVE 62
>E41L2_HUMAN (O43491) Band 4.1-like protein 2 (Generally expressed protein 4.1)| (4.1G) Length = 1005 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +3 Query: 111 GSLEEEKAREASAPVLQVR---QHDDSSMEVRLICCMKRPIKLHEVITIHE 254 G+L+++ EA +V H D + ++ICC + P+ E++TI + Sbjct: 832 GALKQDMGEEAEEEPQKVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISD 882
>OSTA_PHOLL (Q7N8V4) Organic solvent tolerance protein precursor| Length = 774 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +3 Query: 234 EVITIHEEEGAEIINANHSVAGQKMFYT 317 EVI EEE AEI NA VA +FY+ Sbjct: 182 EVILDREEEVAEIWNARFRVANVPIFYS 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,247,042 Number of Sequences: 219361 Number of extensions: 741146 Number of successful extensions: 2189 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2189 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)