| Clone Name | baal15f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GATB_SYNEL (Q8DGC4) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe... | 28 | 7.6 | 2 | ROA1_DROME (P07909) Heterogeneous nuclear ribonucleoprotein A1 (... | 28 | 9.9 |
|---|
>GATB_SYNEL (Q8DGC4) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B| (EC 6.3.5.-) (Asp/Glu-ADT subunit B) Length = 500 Score = 28.5 bits (62), Expect = 7.6 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +2 Query: 287 QYRSSRVQFQGI---EFQKKSEGDEAPKLVSSGLVEKSRP 397 QYR+ + + QG + KKS G PKL + L +K P Sbjct: 459 QYRAGKTKLQGFFVGQLMKKSGGRADPKLANQLLAQKLNP 498
>ROA1_DROME (P07909) Heterogeneous nuclear ribonucleoprotein A1 (hnRNP core| protein A1-A) (PEN repeat clone P9) Length = 365 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -3 Query: 124 GGDDHGWMPSRSAGGALGWMGRGASRWESGTPWS*RHGGAS 2 G D+ G GG G G G + W + PW +GG + Sbjct: 252 GNDNWGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGN 292 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,474,608 Number of Sequences: 219361 Number of extensions: 794187 Number of successful extensions: 2457 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2455 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)