| Clone Name | baal15d21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACDA_METTH (O27743) Acetyl-CoA decarbonylase/synthase complex al... | 29 | 3.2 | 2 | STXB5_MOUSE (Q8K400) Syntaxin-binding protein 5 (Tomosyn-1) (Let... | 28 | 5.5 |
|---|
>ACDA_METTH (O27743) Acetyl-CoA decarbonylase/synthase complex alpha subunit| (EC 1.2.99.2) (ACDS complex alpha subunit) (ACDS complex carbon monoxide dehydrogenase) (ACDS CODH) Length = 780 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +1 Query: 1 AAVEAAHDARMKCVAVASKHPAYELSAADLVVKRLDELSVVDLKNLADIDSP 156 AA + A + C+ + H + D +++RL E +DL + DI++P Sbjct: 97 AATQQARTVLLACLIGTAAHAGHARHLVDHLIERLGEDYKIDLGSNVDIEAP 148
>STXB5_MOUSE (Q8K400) Syntaxin-binding protein 5 (Tomosyn-1) (Lethal(2) giant| larvae protein homolog 3) Length = 1152 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 22 DARMKCVAVASKHPA-YELSAADLVVKRLDELSVVDLKNLADIDSPE 159 ++RM C+A S H Y S +++ + + L V L + D+D+PE Sbjct: 513 ESRMLCIAGVSAHVIIYRFSKQEVLTEVIPMLEVRLLYEINDVDTPE 559 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,381,810 Number of Sequences: 219361 Number of extensions: 547288 Number of successful extensions: 1371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1371 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)