| Clone Name | baal14o10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase ... | 74 | 9e-14 | 2 | RCA_ORYSA (P93431) Ribulose bisphosphate carboxylase/oxygenase a... | 71 | 1e-12 | 3 | RCA_MAIZE (Q9ZT00) Ribulose bisphosphate carboxylase/oxygenase a... | 53 | 3e-07 | 4 | RCAB_HORVU (Q42450) Ribulose bisphosphate carboxylase/oxygenase ... | 40 | 0.001 |
|---|
>RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase activase A,| chloroplast precursor (RuBisCO activase A) (RA A) Length = 464 Score = 74.3 bits (181), Expect = 9e-14 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +2 Query: 2 AAFSSTVGAXASTPTNFLGKKLKKQVTSXVNYHGKSSKA 118 AAFSSTVGA ASTPTNFLGKKLKKQVTS VNYHGKSSKA Sbjct: 3 AAFSSTVGAPASTPTNFLGKKLKKQVTSAVNYHGKSSKA 41
>RCA_ORYSA (P93431) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 432 Score = 70.9 bits (172), Expect = 1e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 AAFSSTVGAXASTPTNFLGKKLKKQVTSXVNYHGKSS 112 AAFSSTVGA ASTPTNFLGKKLKKQVTS VNYHGKSS Sbjct: 3 AAFSSTVGAPASTPTNFLGKKLKKQVTSAVNYHGKSS 39
>RCA_MAIZE (Q9ZT00) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 433 Score = 52.8 bits (125), Expect = 3e-07 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = +2 Query: 2 AAFSSTVGAXASTPT--NFLGKKLKK-QVTSXVNYHGKSSKA 118 AAFSSTVGA ASTPT +FLGKKL K QV++ V YHGKSS + Sbjct: 3 AAFSSTVGAPASTPTRSSFLGKKLNKPQVSAAVTYHGKSSSS 44
>RCAB_HORVU (Q42450) Ribulose bisphosphate carboxylase/oxygenase activase B,| chloroplast precursor (RuBisCO activase B) (RA B) Length = 425 Score = 40.4 bits (93), Expect = 0.001 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +2 Query: 2 AAFSSTVGAXASTPTNFLGKKLKKQVTSXVNYHG 103 +AFSSTVGA ASTPT FLGKK+K YHG Sbjct: 3 SAFSSTVGAPASTPTIFLGKKVKNY------YHG 30 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,368,512 Number of Sequences: 219361 Number of extensions: 78550 Number of successful extensions: 143 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 80,573,946 effective HSP length: 14 effective length of database: 77,502,892 effective search space used: 1860069408 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)