| Clone Name | baal14o03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YCF1A_ANTFO (Q85BK9) Hypothetical 58 kDa protein ycf1 (ORF473) | 32 | 1.3 | 2 | YTR1_EBV (P30119) Hypothetical protein BTRF1 | 30 | 2.9 |
|---|
>YCF1A_ANTFO (Q85BK9) Hypothetical 58 kDa protein ycf1 (ORF473)| Length = 473 Score = 31.6 bits (70), Expect = 1.3 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +3 Query: 300 QKMFYTIHSRASSSRIGIDVPRVSERLRALLQLYSH 407 QK FY+I + SSSR ++ R+++R R L LYS+ Sbjct: 99 QKEFYSIFASDSSSRYTREIERLNKRYRCNLFLYSY 134
>YTR1_EBV (P30119) Hypothetical protein BTRF1| Length = 425 Score = 30.4 bits (67), Expect = 2.9 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 207 CMKRPIKXHEVITIHEEEGAEIIN-ANHSVAGQKMFYTIHSRASSSRIGI 353 C KR V+ ++ GA I+ A H +GQ +F+TIHS +S +G+ Sbjct: 11 CAKRQPPSTAVMLKCKQPGARFIHGAVHLPSGQIVFHTIHSPTLASALGL 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,843,201 Number of Sequences: 219361 Number of extensions: 1328520 Number of successful extensions: 3828 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3828 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)