| Clone Name | baal14n18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KBTB7_HUMAN (Q8WVZ9) Kelch repeat and BTB domain-containing prot... | 28 | 5.6 | 2 | RAG1_BRARE (O13033) V(D)J recombination-activating protein 1 (RA... | 28 | 7.3 | 3 | SPL10_ARATH (Q8S9L0) Squamosa promoter-binding-like protein 10 | 27 | 9.5 |
|---|
>KBTB7_HUMAN (Q8WVZ9) Kelch repeat and BTB domain-containing protein 7| Length = 684 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 118 VVYYYYKTRQAQWWNITFSTK*TQMDDGFI 29 V Y Y TR+ QW NI Q D GFI Sbjct: 583 VTVYEYDTREDQWINIGTMLGLLQFDSGFI 612
>RAG1_BRARE (O13033) V(D)J recombination-activating protein 1 (RAG-1)| Length = 1057 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -2 Query: 328 IPADNCAIHPSQFASNLTTPSVPASLFKGFTNGLYTDVYRHTLKC 194 + D +HPS F T ++ F FTN D HT +C Sbjct: 157 VTTDMETVHPSLFCHRCWTAAIRGGGFCSFTNTRIPDWKPHTSQC 201
>SPL10_ARATH (Q8S9L0) Squamosa promoter-binding-like protein 10| Length = 396 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 100 KTRQAQWWNITFSTK*TQMDDGFIMS 23 ++ + W T+ TK TQM+ GF +S Sbjct: 280 RSEEKYTWGTTYETKPTQMESGFTLS 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,046,669 Number of Sequences: 219361 Number of extensions: 986377 Number of successful extensions: 2045 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2045 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)