| Clone Name | baal14l09 |
|---|---|
| Clone Library Name | barley_pub |
>ZFNL1_ARATH (Q84W91) Zinc finger CCCH type domain-containing protein ZFN-like 1| Length = 468 Score = 31.2 bits (69), Expect = 1.0 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 8 HPRPAGSSLSPPPAILTRFDPPLE 79 HP+PAG+++ PPPA +F P ++ Sbjct: 161 HPQPAGTTVPPPPASAPQFYPSVQ 184
>TIP32_ARATH (O22588) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (Beta-tonoplast intrinsic protein) (Beta-TIP) Length = 267 Score = 30.4 bits (67), Expect = 1.8 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = -3 Query: 422 GLALESSIPDSHLKVVDSSAHGS--GAVGLHDSDVMXVVVDAEVLDGHLVNGHDCKEARA 249 GL +E + + + VV S+A G++G+ + ++V A +L G +G ARA Sbjct: 152 GLLMEIILTFALVYVVYSTAIDPKRGSIGIIAPLAIGLIVGANILVGGPFDGASMNPARA 211 Query: 248 VGGVLLGW 225 G L+GW Sbjct: 212 FGPALVGW 219
>UB2Q2_MOUSE (Q8K2Z8) Ubiquitin-conjugating enzyme E2 Q2 (EC 6.3.2.19)| (Ubiquitin-protein ligase Q2) (Ubiquitin carrier protein Q2) Length = 378 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 2 PPHPRPAGSSLSPPPAI 52 PP P P GSSLSPPP + Sbjct: 41 PPPPPPPGSSLSPPPPL 57
>TIP31_ARATH (P26587) Aquaporin TIP3.1 (Tonoplast intrinsic protein 3.1)| (Alpha-tonoplast intrinsic protein) (Alpha-TIP) Length = 268 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 353 GAVGLHDSDVMXVVVDAEVLDGHLVNGHDCKEARAVGGVLLGW 225 G++G+ + ++V A +L G +G ARA G L+GW Sbjct: 177 GSLGIIAPLAIGLIVGANILVGGPFSGASMNPARAFGPALVGW 219
>VTER_HHV11 (P04295) Probable DNA packaging protein (Terminase)| Length = 735 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -1 Query: 295 LTDILSMDTTAKRPELLAVFCSDGMGSESSAAAVATHSAGDRHR 164 LT +L++ A R +AV +G S+ SA A+ATH + HR Sbjct: 562 LTQVLALHPGAFRGVRVAV---EGNSSQDSAVAIATHVHTEMHR 602 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,082,879 Number of Sequences: 219361 Number of extensions: 671383 Number of successful extensions: 3503 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3490 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)