| Clone Name | baal14k23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RECA_WOLPM (P62222) Protein recA (Recombinase A) | 29 | 4.0 | 2 | GBLP_SCHPO (Q10281) Guanine nucleotide-binding protein beta subu... | 28 | 5.2 | 3 | RECA_WOLTR (Q5GSK9) Protein recA (Recombinase A) | 28 | 5.2 | 4 | PDR5_ARATH (Q9ZUT8) Probable pleiotropic drug resistance protein 5 | 28 | 8.9 |
|---|
>RECA_WOLPM (P62222) Protein recA (Recombinase A)| Length = 355 Score = 28.9 bits (63), Expect = 4.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 97 QKLKLTTTQYELHQPNTGRQPLHIASY 17 +KL ++T + QP+TG Q LHI Y Sbjct: 111 RKLGVSTDDLVISQPDTGEQALHIVEY 137
>GBLP_SCHPO (Q10281) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C) Length = 314 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 95 ETKANNNSVRVTPTKYWAAAVTHSKLQ 15 E KAN N++ +P +YW A T S ++ Sbjct: 231 EAKANINALVFSPNRYWLCAATGSSIR 257
>RECA_WOLTR (Q5GSK9) Protein recA (Recombinase A)| Length = 355 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 97 QKLKLTTTQYELHQPNTGRQPLHIASY 17 +KL + T + QP+TG Q LHI Y Sbjct: 111 RKLGVNTDNLVISQPDTGEQALHIVEY 137
>PDR5_ARATH (Q9ZUT8) Probable pleiotropic drug resistance protein 5| Length = 1413 Score = 27.7 bits (60), Expect = 8.9 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 1 LFVVACNLLCVTAAAQYLVGVTRTELLLALV 93 L+ + CNLLC A +L+ +T ++ A++ Sbjct: 1276 LYAMFCNLLCFNYLAMFLISITPNFMVAAIL 1306 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,806,405 Number of Sequences: 219361 Number of extensions: 264796 Number of successful extensions: 558 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)