| Clone Name | baal14k06 |
|---|---|
| Clone Library Name | barley_pub |
>TMBI1_MOUSE (Q8BJZ3) Transmembrane BAX inhibitor motif-containing protein 1| (RECS1 protein) (Responsive to centrifugal force and shear stress gene 1 protein) Length = 309 Score = 30.4 bits (67), Expect = 2.6 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +2 Query: 248 LDGCSGCGLSVVCMYVFQAANCIGNVVVVHKIIIWMHGLVCSSSSVCLTYLI 403 +D S GL V V + ++V++ K I W+H + + ++C T + Sbjct: 212 VDFTSCTGLFCVLGIVLMVTGIVTSIVLIFKYIYWLHMVYAALGAICFTLFL 263
>YDVG_SCHPO (O14232) Putative helicase C6F12.16c (EC 3.6.1.-)| Length = 1117 Score = 30.4 bits (67), Expect = 2.6 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 8/59 (13%) Frame = -1 Query: 390 KHTLLLLQTRPCIHMIILCTTTTLPMQFAAWNTYIH--------TTDKPQPLQPSSMPT 238 + T++LL + H + L T MQFA W T IH T +P PLQ P+ Sbjct: 326 EETIILLPDKS--HFVFLSATIPNAMQFAEWITKIHRQPCHVVYTDFRPTPLQHYLFPS 382
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 30.4 bits (67), Expect = 2.6 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 147 TQDPRDLQTTAEGLVEEHPSLELRHEREPRQER-DRGEEQQPH 22 T P T L PSLE + ERE R++R DR E Q+ H Sbjct: 41 TVSPSSPATPKRPLRTSTPSLERKREREDREDREDRKERQERH 83
>APX1_CAEEL (P41990) Anterior pharynx in excess protein 1 precursor| Length = 515 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 292 CIPGCKLHWQCSSSAQDNHMDAWSG 366 CI KLHW+CS+ WSG Sbjct: 145 CIANAKLHWECSTHGVRRCSAGWSG 169
>LEGA_PEA (P02857) Legumin A precursor [Contains: Legumin A alpha chain| (Legumin A acidic chain); Legumin A beta chain (Legumin A basic chain)] Length = 517 Score = 30.0 bits (66), Expect = 3.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 93 PSLELRHEREPRQERDRGEEQQP 25 P + RH+R RQE D EE+QP Sbjct: 259 PEKQARHQRGSRQEEDEDEEKQP 281
>HEPA_VZVD (P09300) DNA helicase/primase complex-associated protein| Length = 771 Score = 29.3 bits (64), Expect = 5.7 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 7/39 (17%) Frame = -2 Query: 341 SCALL--LHCQCNLQPGIHTYI-----LLTSHNRYSHPA 246 SCA + + C +L+P IHT++ LL +HN +S P+ Sbjct: 717 SCACIPPIDCAAHLKPLIHTFVTIINHLLDAHNDFSSPS 755
>INVO_SAGOE (P24712) Involucrin| Length = 493 Score = 28.5 bits (62), Expect = 9.7 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 7/97 (7%) Frame = -1 Query: 297 NTYIHTTDKPQPLQPSSMPTIVYLPYY*L-RRQSIHLPIVLAPRRPVLLVPTQDPRDLQT 121 NT +P PL P V LP L + + H+ IV VP Q+ Q Sbjct: 28 NTQQEQRKQPAPLPPPCQKVPVELPVEVLSKHEEKHMTIVKG-------VPEQECEQQQP 80 Query: 120 TAEGLVEEHPSLELRH------EREPRQERDRGEEQQ 28 + L ++H + H E++ +QE+ + E+QQ Sbjct: 81 QEQELQQQHWEQDKEHQKAENPEQQLKQEKVQREKQQ 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,076,595 Number of Sequences: 219361 Number of extensions: 1216964 Number of successful extensions: 4036 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4019 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)