| Clone Name | baal14e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SWC4_USTMA (Q4PG15) SWR1-complex protein 4 | 30 | 2.2 | 2 | ASM_MOUSE (Q04519) Sphingomyelin phosphodiesterase precursor (EC... | 29 | 3.8 | 3 | ASM_HUMAN (P17405) Sphingomyelin phosphodiesterase precursor (EC... | 28 | 5.0 | 4 | ADG3_SCHPO (O74851) Protein adg3 precursor | 28 | 6.5 | 5 | HLES_DROME (Q02308) Protein hairless | 28 | 6.5 |
|---|
>SWC4_USTMA (Q4PG15) SWR1-complex protein 4| Length = 615 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 77 QPRPRIDGSTQAASTLCAPPTTSSAATGNQRAEMKPVVGI 196 +P+P+ DG T+ L S A T AE KPV+G+ Sbjct: 52 RPKPKYDGMTRELFALLGDNAPSLAMTHGLDAEGKPVMGL 91
>ASM_MOUSE (Q04519) Sphingomyelin phosphodiesterase precursor (EC 3.1.4.12)| (Acid sphingomyelinase) (aSMase) Length = 627 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 12/50 (24%) Frame = -2 Query: 206 STPRYPPLASSPPA------------DYRWRRKRWSGEHRESTQPACCRR 93 S P+ PP SPPA D W + G P CCRR Sbjct: 178 SVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCRR 227
>ASM_HUMAN (P17405) Sphingomyelin phosphodiesterase precursor (EC 3.1.4.12)| (Acid sphingomyelinase) (aSMase) Length = 629 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 12/50 (24%) Frame = -2 Query: 206 STPRYPPLASSPPA------------DYRWRRKRWSGEHRESTQPACCRR 93 + P+ PP SPPA D W G + P CCRR Sbjct: 180 TVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRR 229
>ADG3_SCHPO (O74851) Protein adg3 precursor| Length = 1131 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 83 RPRIDGSTQAASTLCAPPTTSSAATGN 163 R IDGS ++S A PT SS+ TG+ Sbjct: 434 RSSIDGSASSSSASLAVPTVSSSTTGS 460
>HLES_DROME (Q02308) Protein hairless| Length = 1077 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 80 PRPRIDGSTQAASTLCAPPTTSSAA 154 P P+++G+ A S APPT++S+A Sbjct: 855 PPPQVNGNGSAGSPTSAPPTSNSSA 879 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,492,214 Number of Sequences: 219361 Number of extensions: 411326 Number of successful extensions: 1353 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1352 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)