ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal14e03 |
|---|---|
| Clone Library Name | barley_pub |
>GP124_HUMAN (Q96PE1) Probable G-protein coupled receptor 124 precursor (Tumor| endothelial marker 5) Length = 1331 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 23 DVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKKWVHLGYIGLW 160 D R W H+RA V G + +A+ + T + + L +IG+W Sbjct: 269 DTRIRWYHNRAPVEGDEQAGILLAESLIHDCTFITSELTLSHIGVW 314
>EGF_MOUSE (P01132) Pro-epidermal growth factor precursor (EGF) [Contains:| Epidermal growth factor] Length = 1217 Score = 31.2 bits (69), Expect = 0.62 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 398 WRTGACSPPPAQRSHRRQTC*TP 330 W+TG C P P +RS R TC P Sbjct: 29 WQTGNCQPGPLERSERSGTCAGP 51
>GUX1_TRIVI (P19355) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase) (1,4-beta-cellobiohydrolase) Length = 514 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 141 RWTHFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAGRTSSS 16 RWTH +S T + +S C D T A++C G +S Sbjct: 56 RWTHATNSSTNCYDGNTWSSTLCPDNETCAKNCCLDGAAYAS 97
>GUX1_TRIRE (P62694) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (CBHI) (1,4-beta-cellobiohydrolase) Length = 513 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 141 RWTHFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAGRTSSS 16 RWTH +S T + +S C D T A++C G +S Sbjct: 56 RWTHATNSSTNCYDGNTWSSTLCPDNETCAKNCCLDGAAYAS 97
>GUX1_TRIKO (P62695) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (CBHI) (1,4-beta-cellobiohydrolase) Length = 513 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 141 RWTHFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAGRTSSS 16 RWTH +S T + +S C D T A++C G +S Sbjct: 56 RWTHATNSSTNCYDGNTWSSTLCPDNETCAKNCCLDGAAYAS 97
>GUX1_TRIHA (Q9P8P3) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (CBHI) (1,4-beta-cellobiohydrolase) Length = 505 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -1 Query: 141 RWTHFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAGRTSS 19 RWTH S T + +S C D T A++C G S Sbjct: 55 RWTHDTKSTTNCYDGNTWSSTLCPDDATCAKNCCLDGANYS 95
>GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 525 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -1 Query: 141 RWTHFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAGRTSSS 16 RWTH +S T + + ++ C D ++ A++C G +S Sbjct: 57 RWTHQVSGSTNCYTGNKWDTSICTDAKSCAQNCCVDGADYTS 98
>PTP3_YEAST (P40048) Tyrosine-protein phosphatase 3 (EC 3.1.3.48)| (Protein-tyrosine phosphatase 3) (PTPase 3) Length = 928 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 17 LLDVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKK 130 LLDVRP EH ++ + S+HV L P TLL++ Sbjct: 117 LLDVRPFTEHAKSIITNSIHVCL--------PSTLLRR 146
>CJ095_HUMAN (Q9H7T3) Protein C10orf95| Length = 257 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 389 GAC----SPPPAQRSHRRQTC*TPRRAIPRSCTRRRAASSPQSA 270 G+C +P PA TC +P A C RRRA SSP +A Sbjct: 189 GSCGARTAPTPAP------TCASPSAAASSCCRRRRACSSPTTA 226
>PUR5_THEVO (Q97CD7) Phosphoribosylformylglycinamidine cyclo-ligase (EC| 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase) Length = 338 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +2 Query: 254 GEGLRSLIAVRMLHDDGYKNVGWLAGGFSKSVD-GDFA 364 GE + S I H + +KN+G++ GGF+ +D G+FA Sbjct: 15 GEFVSSFIRQLKFHREDFKNIGYI-GGFTSLIDMGNFA 51
>YNG2_AZOBR (Q00644) Hypothetical 17.8 kDa protein in nodG 5'region (ORF 2)| Length = 169 Score = 28.5 bits (62), Expect = 4.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 48 TAPRFGGPYTCRCSWP 95 ++PR GGP C C WP Sbjct: 9 SSPRAGGPSACACLWP 24
>YRKF_BACSU (P54433) UPF0033 protein yrkF| Length = 185 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 5 EGFQLLDVRPAWEHDRAAVRGSLHVPL 85 E +LDVR E+++A + G +H+PL Sbjct: 103 ESLNILDVREIEEYEKAHIPGVVHIPL 129
>GUXC_FUSOX (P46238) Putative exoglucanase type C precursor (EC 3.2.1.91)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 514 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 141 RWTHFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAG 31 RWTH S T + + ++ C D +T A C G Sbjct: 55 RWTHQTSGSTNCYTGNKWDTSICTDGKTCAEKCCLDG 91
>USH2A_MOUSE (Q2QI47) Usherin precursor (Usher syndrome type-2A protein homolog)| (Usher syndrome type IIa protein homolog) Length = 5193 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -1 Query: 135 THFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAGRTSSSWNP 7 +H +SVTG S C DP T RSC Q + ++P Sbjct: 957 SHICNSVTGQCS--------CHDPSTTGRSCHQCQESYFRFDP 991
>DRL16_ARATH (O22727) Putative disease resistance protein At1g61190| Length = 967 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 71 LHVPLFMADDDMGPVTLLKKWVHLGYIG 154 L+ LF DD + TL+ KW+ G+IG Sbjct: 410 LYCALFPEDDKIDTKTLINKWICEGFIG 437
>SELU_SALTY (Q8ZR88) tRNA 2-selenouridine synthase (EC 2.9.1.-)| (Selenophosphate-dependent tRNA 2-selenouridine synthase) Length = 364 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 17 LLDVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKK 130 L+DVR E ++ A+ G++++PL M D+ T K+ Sbjct: 20 LIDVRAPIEFEQGAMPGAINLPLMMDDERAAVGTCYKR 57
>SELU_SALTI (Q8Z8R4) tRNA 2-selenouridine synthase (EC 2.9.1.-)| (Selenophosphate-dependent tRNA 2-selenouridine synthase) Length = 364 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 17 LLDVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKK 130 L+DVR E ++ A+ G++++PL M D+ T K+ Sbjct: 20 LIDVRAPIEFEQGAMPGAINLPLMMDDERAAVGTCYKR 57
>SELU_SALPA (Q5PCH1) tRNA 2-selenouridine synthase (EC 2.9.1.-)| (Selenophosphate-dependent tRNA 2-selenouridine synthase) Length = 364 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 17 LLDVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKK 130 L+DVR E ++ A+ G++++PL M D+ T K+ Sbjct: 20 LIDVRAPIEFEQGAMPGAINLPLMMDDERAAVGTCYKR 57
>SELU_SALEN (Q9S4Y8) tRNA 2-selenouridine synthase (EC 2.9.1.-)| (Selenophosphate-dependent tRNA 2-selenouridine synthase) Length = 364 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 17 LLDVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKK 130 L+DVR E ++ A+ G++++PL M D+ T K+ Sbjct: 20 LIDVRAPIEFEQGAMPGAINLPLMMDDERAAVGTCYKR 57
>SELU_SALCH (Q57S51) tRNA 2-selenouridine synthase (EC 2.9.1.-)| (Selenophosphate-dependent tRNA 2-selenouridine synthase) Length = 364 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 17 LLDVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKK 130 L+DVR E ++ A+ G++++PL M D+ T K+ Sbjct: 20 LIDVRAPIEFEQGAMPGAINLPLMMDDERAAVGTCYKR 57
>IDHP_ASPNG (P79089) Isocitrate dehydrogenase [NADP], mitochondrial precursor| (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP(+)-specific ICDH) (IDP) Length = 498 Score = 27.7 bits (60), Expect = 6.8 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = -1 Query: 195 KRSFILVKDCPVQSPM*PRWTHFLSSVTGPMSSSAMNSGTCRDPR--TAARSCSQAGRTS 22 +RSF + P+ +P+ FLSS + +SSS+ + T R PR T+A S + S Sbjct: 12 RRSFAVASP-PLSAPLSSSARRFLSSSSSTISSSSSSVST-RSPRSLTSASSLLSSRTAS 69 Query: 21 SSW 13 + W Sbjct: 70 ARW 72
>GUX2_AGABI (Q92400) Exoglucanase precursor (EC 3.2.1.91)| (Exocellobiohydrolase) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 506 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 141 RWTHFLSSVTGPMSSSAMNSGTCRDPRTAARSCSQAG 31 RWTH ++ T + + ++ C D T A +C+ G Sbjct: 56 RWTHRINDFTNCYTGNEWDTSICPDGVTCAENCALDG 92
>KLK11_HUMAN (Q9UBX7) Kallikrein-11 precursor (EC 3.4.21.-) (Hippostasin)| (Trypsin-like protease) Length = 282 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 9 GSSCWTSGRPGSTTAPRFGGPYTCRCS 89 G+SC SG GST++P+ P+T RC+ Sbjct: 171 GTSCLISGW-GSTSSPQLRLPHTLRCA 196
>HBD_CLOAB (P52041) 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)| (Beta-hydroxybutyryl-CoA dehydrogenase) (BHBD) Length = 282 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 95 DDDMGPVTLLKKWVHLGYIGLWTGQSF 175 D P TLLKK+V G++G +G+ F Sbjct: 251 DSKYRPHTLLKKYVRAGWLGRKSGKGF 277
>ASAHL_HUMAN (Q02083) N-acylethanolamine-hydrolyzing acid amidase precursor (EC| 3.5.1.-) (N-acylsphingosine amidohydrolase-like) (ASAH-like protein) (Acid ceramidase-like protein) Length = 359 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +2 Query: 140 LGYIGLWTGQS 172 +GY+GLWTGQS Sbjct: 175 IGYVGLWTGQS 185
>VIT1_CHICK (P87498) Vitellogenin-1 precursor (Vitellogenin I) (Minor| vitellogenin) [Contains: Lipovitellin-1 (Lipovitellin I) (LVI); Phosvitin (PV); Lipovitellin-2 (Lipovitellin II) (LVII); YGP42] Length = 1912 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -1 Query: 123 SSVTGPMSSSAMNSGTCRDPRTAARSCSQAGRTSSSWNPS 4 SS +G SSS+ +S + D +++RS S + +SSS + S Sbjct: 1150 SSSSGSSSSSSSSSSSSSDSSSSSRSSSSSDSSSSSSSSS 1189
>GIGAN_ORYSA (Q9AWL7) GIGANTEA protein| Length = 1160 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 11 FQLLDVRPAWEHDRAAVRGSLHVPLFMADDDMGPVTLLKKWVHLGYI 151 F LL+ P+W D L L A+D + L K W+HL ++ Sbjct: 328 FGLLEAPPSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLHFL 374
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 380 SPPPAQRSHRRQTC*TPRRAIPRSCTRRRAASSP 279 SPPPA+R PRR S RRR+ S P Sbjct: 545 SPPPARRRRSPSPPPPPRRRRSPSLPRRRSPSPP 578 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,034,454 Number of Sequences: 219361 Number of extensions: 924585 Number of successful extensions: 3276 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 3084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3268 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
