| Clone Name | baal13o15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBE3C_MOUSE (Q80U95) Ubiquitin-protein ligase E3C (EC 6.3.2.-) | 29 | 3.6 | 2 | RPOC1_PSINU (Q8WI25) DNA-directed RNA polymerase beta' chain (EC... | 28 | 4.7 |
|---|
>UBE3C_MOUSE (Q80U95) Ubiquitin-protein ligase E3C (EC 6.3.2.-)| Length = 1083 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -2 Query: 180 YLTVQKGSNSKTLLLEQTMHRAIHSSTNKSVYLAIS 73 YL V + S+ ++EQ +H +HS +S+YL I+ Sbjct: 181 YLPVLQDSSYVVSVIEQILHYMVHSGYYRSLYLLIN 216
>RPOC1_PSINU (Q8WI25) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta' subunit) (RNA polymerase beta' subunit) Length = 674 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 166 LYRKIYYCRNTSVYLIQRTEMNPDG 240 LYRK+ Y NT + + R+E P+G Sbjct: 300 LYRKVIYRNNTLIDFLLRSEFTPEG 324 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,635,213 Number of Sequences: 219361 Number of extensions: 643938 Number of successful extensions: 1470 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1470 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)