| Clone Name | baal13n18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EX5A_BUCAI (P57530) Exodeoxyribonuclease V alpha chain (EC 3.1.1... | 32 | 1.3 | 2 | YTHD1_HUMAN (Q9BYJ9) YTH domain protein 1 (Dermatomyositis assoc... | 31 | 2.9 | 3 | YTHD1_MOUSE (P59326) YTH domain protein 1 (Dermatomyositis assoc... | 30 | 6.6 | 4 | Y567_BUCAP (Q8K902) Hypothetical transport protein BUsg567 | 30 | 8.6 |
|---|
>EX5A_BUCAI (P57530) Exodeoxyribonuclease V alpha chain (EC 3.1.11.5)| Length = 602 Score = 32.3 bits (72), Expect = 1.3 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = +3 Query: 426 MKLVRIIHYY*KQELGDS---IIIYVSRINYSSKRSYITLPGEYSSKFFCSFFST 581 +K++R I +Y Q + +++ + ++Y S R YI+LP +Y K + FFS+ Sbjct: 11 LKIIRPIDFYFSQFIAQKNNIVMLVAACVSYESSRGYISLPIKYFEKHY--FFSS 63
>YTHD1_HUMAN (Q9BYJ9) YTH domain protein 1 (Dermatomyositis associated with| cancer putative autoantigen 1) (DACA-1) Length = 559 Score = 31.2 bits (69), Expect = 2.9 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -3 Query: 263 NQHETPTICRQEHLSSYYMMSGCSPYAGDGKQWASAGS--TPYFSTLGSV*LQTNTDRH 93 NQ + +LSSYY S PY+ + W++AG PY +T G + +N D H Sbjct: 43 NQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQL---SNGDHH 98
>YTHD1_MOUSE (P59326) YTH domain protein 1 (Dermatomyositis associated with| cancer putative autoantigen 1 homolog) (DACA-1 homolog) Length = 559 Score = 30.0 bits (66), Expect = 6.6 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -3 Query: 227 HLSSYYMMSGCSPYAGDGKQWASAGS--TPYFSTLGSV*LQTNTDRH 93 +LSSYY S PY+ W++AG PY +T G + +N D H Sbjct: 55 YLSSYYPPSIGFPYSLSEAPWSTAGDPPIPYLTTYGQL---SNGDHH 98
>Y567_BUCAP (Q8K902) Hypothetical transport protein BUsg567| Length = 413 Score = 29.6 bits (65), Expect = 8.6 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +1 Query: 520 VLILLYRGSIHLNSFALFFQLIAYKLHLDIYFHNIYDSKTNLGYISNIML 669 +LIL G + + SF F I+Y+L L +F S +N+G++S I L Sbjct: 240 LLILFAIGFMLMGSFITIFNYISYRLMLSPFFL----SSSNIGFLSIIYL 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,188,613 Number of Sequences: 219361 Number of extensions: 1893491 Number of successful extensions: 3848 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3848 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)