| Clone Name | baal13m24 |
|---|---|
| Clone Library Name | barley_pub |
>ATG5_MAGGR (Q525E4) Autophagy protein 5| Length = 314 Score = 32.3 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 2 PGSLPSTLPDPIPSPLRPVSFLLVAGTSEPPP 97 PGS P + P P P RP+S + A S PPP Sbjct: 18 PGSGPPSPPHPGPDSARPLSRITSAAASPPPP 49
>DIAP1_MOUSE (O08808) Protein diaphanous homolog 1 (Diaphanous-related formin-1)| (DRF1) (mDIA1) (p140mDIA) Length = 1255 Score = 31.2 bits (69), Expect = 2.1 Identities = 23/75 (30%), Positives = 28/75 (37%) Frame = +2 Query: 14 PSTLPDPIPSPLRPVSFLLVAGTSEPPPHPQEGQGAILPRAATXXXXXXXXXXXXXXTVA 193 P P P+P + P S L GT PPP P G I P + A Sbjct: 587 PPPPPPPLPGGVVPPSPPLPPGTCIPPPPPLPGGACIPPPP------------QLPGSAA 634 Query: 194 VPVPPELDSVP*LGP 238 +P PP L V + P Sbjct: 635 IPPPPPLPGVASIPP 649
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 8 SLPSTLPDPIPSPLRPVSFLLVAGTSEPPPHP-QEGQGAILP 130 S+ ST P P+P P P + L A PPP P Q G + P Sbjct: 343 SMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHP 384
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 8 SLPSTLPDPIPSPLRPVSFLLVAGTSEPPPHP-QEGQGAILP 130 S+ ST P P+P P P + L A PPP P Q G + P Sbjct: 343 SMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHP 384
>TSP1_XENLA (P35448) Thrombospondin-1 precursor| Length = 1173 Score = 29.6 bits (65), Expect = 6.1 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -3 Query: 505 SNQLRQWRTCSSVTPQLGSQICQVH-HYGALCTVSGMPNYAR*GRSAAWSICLLVCG 338 S Q+ + R C+S PQL + C+ C P + G + W C + CG Sbjct: 456 SGQITRIRLCNSPVPQLNGKQCEGEGRENKPCQKDPCPINGQWGPWSLWDTCTVTCG 512
>UNC5B_XENLA (Q8JGT4) Netrin receptor UNC5B precursor (UNC-5 homolog) (Protein| XUNC-5) Length = 943 Score = 29.6 bits (65), Expect = 6.1 Identities = 16/60 (26%), Positives = 24/60 (40%) Frame = -3 Query: 493 RQWRTCSSVTPQLGSQICQVHHYGALCTVSGMPNYAR*GRSAAWSICLLVCGHLRGDEPN 314 ++ RTC++ P G +C+ Y + P + WS C C H R E N Sbjct: 271 KRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACSTECTHWRSRECN 330
>AB1IP_BRARE (Q6PFT9) Amyloid beta A4 precursor protein-binding family B member| 1-interacting protein (APBB1-interacting protein 1) Length = 646 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 8 SLPSTLPDPIPS-PLRPVSFLLVAGTSEPPPHP 103 SLP PDP+ S P P +F G PPP P Sbjct: 559 SLPPPPPDPVASLPPPPPAFTSAGGAPPPPPPP 591
>RD23A_MOUSE (P54726) UV excision repair protein RAD23 homolog A (mHR23A)| Length = 363 Score = 29.3 bits (64), Expect = 8.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 14 PSTLPDPIPSPLRPVSFLLVAGTSEPPPHPQE 109 P P +P P P +L +G S PPP +E Sbjct: 89 PEASPTAVPEPSTPFPPVLASGMSHPPPTSRE 120
>DIAP1_HUMAN (O60610) Protein diaphanous homolog 1 (Diaphanous-related formin-1)| (DRF1) Length = 1248 Score = 29.3 bits (64), Expect = 8.0 Identities = 22/71 (30%), Positives = 24/71 (33%) Frame = +2 Query: 2 PGSLPSTLPDPIPSPLRPVSFLLVAGTSEPPPHPQEGQGAILPRAATXXXXXXXXXXXXX 181 P ST P P P P P L GT+ PP P G I P Sbjct: 591 PAPGDSTTPPPPPPPPPPPP-PLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLP 649 Query: 182 XTVAVPVPPEL 214 A+P PP L Sbjct: 650 GGTAIPPPPPL 660
>DEC1_DROER (Q23933) Defective chorion-1 protein precursor (Fragments)| Length = 557 Score = 29.3 bits (64), Expect = 8.0 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 2 PGSLPSTLPDPIPSPLRPVSFLLVAGTSEPP--PHPQEGQGAILPRAA 139 P L + P P P+P + L A ++PP P P Q AIL +AA Sbjct: 173 PSILGAAAPVPAPAPAPAATPLAPAPAADPPAAPVPDAAQPAILGQAA 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,057,565 Number of Sequences: 219361 Number of extensions: 1594941 Number of successful extensions: 5328 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5280 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)