| Clone Name | baal13m06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TCB1_RABIT (P06333) T-cell receptor beta chain ANA 11 | 32 | 1.5 | 2 | NUOL_BUCAI (P57262) NADH-quinone oxidoreductase chain L (EC 1.6.... | 31 | 2.6 |
|---|
>TCB1_RABIT (P06333) T-cell receptor beta chain ANA 11| Length = 319 Score = 32.0 bits (71), Expect = 1.5 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 10/54 (18%) Frame = -1 Query: 295 THTPTRTSAHVRART----HTHTYIH-CI----*SLNLICVPC-SFPHDKCGTN 164 THT T T H+ A T HTHT+ H CI +L L C P ++ H + T+ Sbjct: 65 THTHTCTHTHIHASTHVCIHTHTFTHLCIHTLTHALTLTCAPTRTYAHTRAPTH 118 Score = 30.0 bits (66), Expect = 5.7 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -1 Query: 295 THTPTRTSAHVRARTHTHTYIHCI*SLN---LICVPCSFPHD 179 T PTRT AH RA TH H + L+ L+ P FP D Sbjct: 103 TCAPTRTYAHTRAPTHVHPHKPRPRQLSAALLLPTPLHFPED 144
>NUOL_BUCAI (P57262) NADH-quinone oxidoreductase chain L (EC 1.6.99.5) (NADH| dehydrogenase I, chain L) (NDH-1, chain L) Length = 614 Score = 31.2 bits (69), Expect = 2.6 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 381 FTDFLNQLSFRTVSPTLRLFGL*QTKSYFVWYANKYIFDHSLKFNFYM*QYY 536 +T ++ +F + L L G+ SY++W N Y+ D +F F YY Sbjct: 483 YTPIDHKFAFEIICSILSLSGI--YLSYYIWIKNLYVLDKIFQFKFMRYLYY 532 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,285,536 Number of Sequences: 219361 Number of extensions: 1606261 Number of successful extensions: 3168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3098 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)