| Clone Name | baal14a19 |
|---|---|
| Clone Library Name | barley_pub |
>T3RE_SALTY (P40815) Type III restriction-modification system StyLTI enzyme res| (EC 3.1.21.5) Length = 990 Score = 31.6 bits (70), Expect = 0.48 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 123 GSGLRLGLDENPDAIISGEWPENFS-LLSYDD 215 G GLRL +DEN + EWP S L+ YD+ Sbjct: 534 GRGLRLPVDENGHRVHQEEWPSRLSFLIGYDE 565
>T3RE_BACC1 (P25241) Type III restriction-modification system Bce10987IP enzyme| res (EC 3.1.21.5) Length = 987 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 123 GSGLRLGLDENPDAIISGEWPENFS-LLSYDD 215 G GLRL +DE I EWP + L+ YD+ Sbjct: 536 GRGLRLPVDETGHRIQQDEWPTRLAFLIGYDE 567
>MCM4_SCHPO (P29458) DNA replication licensing factor mcm4 (Minichromosome| maintenance protein 4) (Cell division control protein 21) Length = 931 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 144 LDENPDAIISGEWPENFSLLSYDDL 218 L E PD + G+ P + SL YD+L Sbjct: 376 LQETPDVVPDGQTPHSVSLCVYDEL 400
>YACK_RHIME (Q9X447) Hypothetical 80.6 kDa protein in ackA 5'region (ORFA)| Length = 733 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 150 ENPDAIISGEWPENFSLLSYDDLRAY 227 ENPD ++SGEW + DD+RA+ Sbjct: 413 ENPD-LVSGEWIMRCEARTLDDIRAF 437
>Y1355_MYCTU (Q11025) Hypothetical protein Rv1355c/MT1398| Length = 715 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 309 AMSTPVLMATADQALVEVE 365 A PVLMAT+D+ LV+VE Sbjct: 218 ARGVPVLMATSDRGLVDVE 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,524,288 Number of Sequences: 219361 Number of extensions: 304148 Number of successful extensions: 744 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)