| Clone Name | baal13g23 |
|---|---|
| Clone Library Name | barley_pub |
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 68 IQCPENPRFPPQGSSTEGESGPK 136 +Q E PR PPQ +T GE GP+ Sbjct: 67 VQLEEEPRGPPQREATPGEPGPR 89
>GP176_MOUSE (Q80WT4) Probable G-protein coupled receptor 176 (G-protein coupled| receptor AGR9) Length = 515 Score = 28.5 bits (62), Expect = 4.5 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = +2 Query: 17 DEAEARM--SA*VTKTLVRIQCPENPRFPPQGSSTEGESGPKIRPKGVVDGQQVNIPVLP 190 +E+EA+ SA V CPE + PPQ P + P G VD + PV P Sbjct: 387 EESEAKYLGSADFQAKEVLTSCPEGEQEPPQ-------LAPSVPPPGTVDSEPRVSPVAP 439 Query: 191 L 193 + Sbjct: 440 M 440
>VL2_HPV58 (P26538) Minor capsid protein L2| Length = 472 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 255 VSLNL*PSFG*PSLLRPSVPTRGSTGILTCCPSTT 151 VS +L PSF PS+LRP P S ++ P+ + Sbjct: 155 VSTHLNPSFTEPSVLRPPAPAEASGHLIFSSPTVS 189
>GUN9_ARATH (Q9C9H5) Probable family 9 endoglucanase At1g71380 precursor (EC| 3.2.1.4) Length = 484 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -3 Query: 222 PSLLRPSVPTRGSTGILTCCPSTTPFGLILGPDSPSVDEPC 100 P L V R +T L C TP L +G P+VD C Sbjct: 105 PELENARVNIRWATDYLLKCARATPGKLYVGVGDPNVDHKC 145
>ZN580_HUMAN (Q9UK33) Zinc finger protein 580 (LDL-induced EC protein)| Length = 172 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 68 IQCPENPRFPPQGSSTEGESGPK 136 +Q E PR PPQ + GE GP+ Sbjct: 67 VQLEEEPRGPPQREAPPGEPGPR 89
>THIE_STRAW (Q82AF9) Thiamine-phosphate pyrophosphorylase (EC 2.5.1.3) (TMP| pyrophosphorylase) (TMP-PPase) (Thiamine-phosphate synthase) Length = 215 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +1 Query: 61 GENPMPRKPKVSSARFVHGG*VRA*DQAERRSRWTTGQYSCTTPCWYGGTEEARLA 228 G+ P+P + A + G A +AE + Y CT PCW T+ R A Sbjct: 94 GDLPVPAARAILGADVLIGRSTHAEAEAEAAAVQEGVDYFCTGPCWPTPTKPGRHA 149
>VL2_HPV32 (P36757) Minor capsid protein L2| Length = 476 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 237 PSFG*PSLLRPSVPTRGSTGILTCCPSTTP 148 P + P LRPS+P G+ +LT P+ P Sbjct: 164 PVYSDPFTLRPSLPVEGNGRLLTSHPTIAP 193
>METE_BACSU (P80877) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) (Superoxide-inducible protein 9) (SOI9) Length = 761 Score = 27.7 bits (60), Expect = 7.7 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 4/69 (5%) Frame = +1 Query: 31 ENVGLSNENIGENPMPRKPKVSSARFVHGG*VRA*DQAERRSRWTTGQY----SCTTPCW 198 E + L NE++G +P P + F VR Q R++ W+ QY + T W Sbjct: 415 ERLALQNESLG---LPLLPTTTIGSFPQSAEVRRARQKWRKAEWSDEQYQNFINAETKRW 471 Query: 199 YGGTEEARL 225 EE L Sbjct: 472 IDIQEELEL 480
>PYRD_FUSNN (Q8RG85) Dihydroorotate dehydrogenase (EC 1.3.3.1) (Dihydroorotate| oxidase) (DHOdehase) (DHODase) (DHOD) Length = 304 Score = 27.7 bits (60), Expect = 7.7 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +2 Query: 56 TLVRIQCPENPRFPPQGSSTEGESGPKIRPKGV----VDGQQVNIPVLPLVG 199 TLV I P ++T G SGP IRP + Q VNIP++ + G Sbjct: 194 TLVGIVLDRKTGKPIIANTTGGLSGPAIRPVAIRMVYQVAQAVNIPIIGMGG 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,614,325 Number of Sequences: 219361 Number of extensions: 955166 Number of successful extensions: 2655 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2655 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)